Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EUU4

Protein Details
Accession A7EUU4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-79ADKKRGCGKRLPSKYKVKRFSTKRRTLKSNENSKLHydrophilic
NLS Segment(s)
PositionSequence
48-69KRGCGKRLPSKYKVKRFSTKRR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG ssl:SS1G_09102  -  
Amino Acid Sequences MQPDAPSQPLSLKTKQDRTNYTPQATYEWCSMRSSNPKSRVNPCADKKRGCGKRLPSKYKVKRFSTKRRTLKSNENSKLPTYFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.64
4 0.65
5 0.67
6 0.72
7 0.7
8 0.64
9 0.57
10 0.51
11 0.47
12 0.41
13 0.36
14 0.29
15 0.24
16 0.23
17 0.22
18 0.22
19 0.24
20 0.31
21 0.36
22 0.4
23 0.47
24 0.52
25 0.55
26 0.6
27 0.61
28 0.58
29 0.6
30 0.59
31 0.61
32 0.6
33 0.58
34 0.58
35 0.61
36 0.62
37 0.56
38 0.56
39 0.55
40 0.61
41 0.69
42 0.72
43 0.7
44 0.74
45 0.81
46 0.84
47 0.84
48 0.81
49 0.81
50 0.83
51 0.86
52 0.86
53 0.87
54 0.87
55 0.86
56 0.86
57 0.83
58 0.84
59 0.83
60 0.83
61 0.78
62 0.75
63 0.7
64 0.65