Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F8P1

Protein Details
Accession A7F8P1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRERVVVRRRRRRVERGVMGRFGBasic
NLS Segment(s)
PositionSequence
8-13RRRRRR
Subcellular Location(s) mito 16, nucl 9, cyto 1.5, cyto_pero 1.5
Family & Domain DBs
KEGG ssl:SS1G_13972  -  
Amino Acid Sequences MRERVVVRRRRRRVERGVMGRFGWGFDGVVGLGSGLGLVDEDGGAGDGEDEDVDRSQEIANYWVSYKSAKLSVERGSEEFGWMEKIVDGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.84
5 0.76
6 0.66
7 0.58
8 0.47
9 0.36
10 0.27
11 0.17
12 0.11
13 0.08
14 0.08
15 0.06
16 0.06
17 0.05
18 0.04
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.07
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.12
55 0.15
56 0.16
57 0.18
58 0.22
59 0.27
60 0.3
61 0.32
62 0.31
63 0.3
64 0.29
65 0.28
66 0.24
67 0.19
68 0.17
69 0.15
70 0.15