Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8UKI6

Protein Details
Accession A0A0F8UKI6   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
199-229DADPNSNPTDKKKKKKKRKYRSAERQSAQSPHydrophilic
NLS Segment(s)
PositionSequence
209-220KKKKKKKRKYRS
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPCGLTSSTSRPSALSRPKLTLQTSSLPITFGSSSTGLSLSLAAGTASPTVRNTFKNAYDLPCPQSATASPSRSTSRLSKPSSPFTSTNPYQLPLGVRSILRNTPLEPTRRRSNSVAPGGPTGASGSRRVYFPPKKQVTYRNPLEEVIKTVVYTARHSDLDSEPEPEISEAGSDEESDYSASTSSSTSSSSSSITSDEDADPNSNPTDKKKKKKKRKYRSAERQSAQSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.47
4 0.5
5 0.54
6 0.59
7 0.57
8 0.53
9 0.47
10 0.43
11 0.43
12 0.4
13 0.36
14 0.3
15 0.27
16 0.25
17 0.21
18 0.16
19 0.15
20 0.13
21 0.13
22 0.13
23 0.13
24 0.1
25 0.1
26 0.1
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.07
36 0.09
37 0.12
38 0.15
39 0.16
40 0.21
41 0.24
42 0.26
43 0.3
44 0.32
45 0.32
46 0.34
47 0.36
48 0.34
49 0.31
50 0.3
51 0.25
52 0.24
53 0.22
54 0.23
55 0.26
56 0.25
57 0.23
58 0.26
59 0.28
60 0.28
61 0.31
62 0.32
63 0.34
64 0.4
65 0.44
66 0.49
67 0.51
68 0.58
69 0.58
70 0.56
71 0.49
72 0.45
73 0.48
74 0.41
75 0.41
76 0.34
77 0.31
78 0.26
79 0.26
80 0.23
81 0.16
82 0.17
83 0.13
84 0.12
85 0.13
86 0.15
87 0.15
88 0.15
89 0.15
90 0.14
91 0.18
92 0.22
93 0.27
94 0.28
95 0.32
96 0.39
97 0.41
98 0.44
99 0.41
100 0.44
101 0.46
102 0.48
103 0.44
104 0.36
105 0.34
106 0.3
107 0.27
108 0.2
109 0.13
110 0.1
111 0.09
112 0.1
113 0.11
114 0.12
115 0.12
116 0.14
117 0.23
118 0.29
119 0.35
120 0.44
121 0.47
122 0.5
123 0.54
124 0.62
125 0.61
126 0.63
127 0.62
128 0.56
129 0.52
130 0.5
131 0.47
132 0.38
133 0.32
134 0.25
135 0.2
136 0.15
137 0.14
138 0.16
139 0.15
140 0.16
141 0.15
142 0.16
143 0.16
144 0.17
145 0.2
146 0.18
147 0.23
148 0.22
149 0.22
150 0.19
151 0.19
152 0.19
153 0.15
154 0.14
155 0.08
156 0.08
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.08
173 0.09
174 0.09
175 0.11
176 0.12
177 0.12
178 0.13
179 0.12
180 0.13
181 0.13
182 0.13
183 0.14
184 0.15
185 0.15
186 0.16
187 0.17
188 0.17
189 0.18
190 0.18
191 0.19
192 0.19
193 0.27
194 0.37
195 0.45
196 0.56
197 0.65
198 0.75
199 0.83
200 0.93
201 0.95
202 0.95
203 0.97
204 0.97
205 0.97
206 0.97
207 0.97
208 0.96
209 0.89