Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F0IFX1

Protein Details
Accession A0A0F0IFX1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
190-209IPFSRPIKKVHRSRKPLLVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 6, pero 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000383  Xaa-Pro-like_dom  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF02129  Peptidase_S15  
Amino Acid Sequences MGHGFGAVKAGGLFPFAERFAEAGYAAVMFDYLFFGESDGLPRNLLSISRELQDFRDVIAWVRRQTDKWDTDRVIAWGASFGGMHVTTLMAEDHDLVAGIMQGPCVDGLAASRQVPVFKTLRLLPLSLFDWILSPFSSKAIYIPLIGDGKHGSSLAMMSGSEAMAGWKRLTTDLGADFVNKVTARTILTIPFSRPIKKVHRSRKPLLVVVTTWDNEAPLHKAKQAVRLAPLGEGFRVPGGHFDLYAGGVAFEDNIRRQLQFLQKVLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.11
4 0.12
5 0.11
6 0.12
7 0.12
8 0.12
9 0.11
10 0.09
11 0.08
12 0.07
13 0.07
14 0.06
15 0.05
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.07
24 0.08
25 0.11
26 0.13
27 0.14
28 0.13
29 0.13
30 0.13
31 0.13
32 0.14
33 0.13
34 0.15
35 0.16
36 0.18
37 0.19
38 0.19
39 0.2
40 0.23
41 0.2
42 0.17
43 0.18
44 0.16
45 0.18
46 0.24
47 0.25
48 0.24
49 0.29
50 0.3
51 0.28
52 0.35
53 0.41
54 0.41
55 0.41
56 0.47
57 0.44
58 0.44
59 0.44
60 0.38
61 0.31
62 0.25
63 0.2
64 0.13
65 0.11
66 0.09
67 0.08
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.06
97 0.07
98 0.07
99 0.08
100 0.09
101 0.1
102 0.1
103 0.14
104 0.13
105 0.12
106 0.14
107 0.14
108 0.18
109 0.18
110 0.18
111 0.14
112 0.16
113 0.16
114 0.14
115 0.13
116 0.09
117 0.08
118 0.08
119 0.09
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.06
126 0.06
127 0.08
128 0.08
129 0.08
130 0.08
131 0.09
132 0.1
133 0.1
134 0.1
135 0.08
136 0.08
137 0.08
138 0.08
139 0.06
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.06
153 0.06
154 0.06
155 0.07
156 0.08
157 0.09
158 0.09
159 0.1
160 0.1
161 0.12
162 0.11
163 0.11
164 0.11
165 0.1
166 0.12
167 0.1
168 0.09
169 0.09
170 0.1
171 0.1
172 0.12
173 0.13
174 0.13
175 0.17
176 0.18
177 0.18
178 0.23
179 0.25
180 0.27
181 0.28
182 0.33
183 0.39
184 0.48
185 0.57
186 0.61
187 0.69
188 0.74
189 0.78
190 0.81
191 0.77
192 0.72
193 0.65
194 0.57
195 0.46
196 0.42
197 0.39
198 0.3
199 0.25
200 0.2
201 0.17
202 0.14
203 0.15
204 0.16
205 0.18
206 0.19
207 0.2
208 0.27
209 0.29
210 0.38
211 0.42
212 0.41
213 0.39
214 0.4
215 0.39
216 0.34
217 0.34
218 0.26
219 0.21
220 0.17
221 0.15
222 0.13
223 0.13
224 0.12
225 0.12
226 0.15
227 0.15
228 0.15
229 0.15
230 0.14
231 0.14
232 0.14
233 0.11
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.1
240 0.11
241 0.15
242 0.17
243 0.17
244 0.18
245 0.26
246 0.35
247 0.4