Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F0IL33

Protein Details
Accession A0A0F0IL33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-101YRNWYKTPKGWVKQNDKPRNCQGPRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, mito 3, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MKSPIYLLTALLPLTLPLVNASPTAEPDDLDVEGSVLEDRDNCRVDRGFNYYKYPCDSSDITGRANRGDNVNFQCRYRNWYKTPKGWVKQNDKPRNCQGPRPNSCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.07
5 0.08
6 0.09
7 0.09
8 0.1
9 0.09
10 0.1
11 0.14
12 0.13
13 0.12
14 0.13
15 0.14
16 0.12
17 0.12
18 0.11
19 0.07
20 0.07
21 0.07
22 0.06
23 0.04
24 0.04
25 0.05
26 0.07
27 0.11
28 0.12
29 0.12
30 0.15
31 0.16
32 0.18
33 0.19
34 0.25
35 0.26
36 0.26
37 0.31
38 0.3
39 0.31
40 0.32
41 0.31
42 0.24
43 0.23
44 0.22
45 0.19
46 0.24
47 0.24
48 0.23
49 0.23
50 0.23
51 0.21
52 0.21
53 0.2
54 0.17
55 0.17
56 0.22
57 0.25
58 0.31
59 0.31
60 0.3
61 0.34
62 0.32
63 0.38
64 0.39
65 0.42
66 0.43
67 0.53
68 0.6
69 0.62
70 0.71
71 0.74
72 0.74
73 0.75
74 0.77
75 0.76
76 0.78
77 0.82
78 0.82
79 0.77
80 0.79
81 0.8
82 0.81
83 0.75
84 0.76
85 0.75
86 0.76