Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EQK8

Protein Details
Accession A7EQK8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
127-153QKFSRYGREGNKRPKGKRIKSNEEGAWHydrophilic
NLS Segment(s)
PositionSequence
134-146REGNKRPKGKRIK
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 7, cyto 5
Family & Domain DBs
KEGG ssl:SS1G_07610  -  
Amino Acid Sequences MRDVGTQFSGPGAKVKTGREEEIEIYTPSVVLKKGFRTNPNPNYSKFVDPDSVSPSKPVSRQIFSPAPSFISTSFNKPRDSPYNRKVPNTAMRQPQFRQTTPNSVTSTSAGTADGGSLGTRSSRYTQKFSRYGREGNKRPKGKRIKSNEEGAWRQRSATIWQIIIFRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.34
4 0.37
5 0.39
6 0.37
7 0.38
8 0.36
9 0.36
10 0.36
11 0.27
12 0.23
13 0.21
14 0.17
15 0.15
16 0.14
17 0.11
18 0.11
19 0.14
20 0.2
21 0.28
22 0.34
23 0.41
24 0.48
25 0.58
26 0.64
27 0.69
28 0.66
29 0.61
30 0.61
31 0.57
32 0.52
33 0.43
34 0.36
35 0.32
36 0.29
37 0.29
38 0.3
39 0.28
40 0.24
41 0.24
42 0.23
43 0.22
44 0.23
45 0.29
46 0.27
47 0.27
48 0.28
49 0.34
50 0.36
51 0.35
52 0.35
53 0.28
54 0.24
55 0.23
56 0.22
57 0.16
58 0.17
59 0.16
60 0.21
61 0.28
62 0.29
63 0.3
64 0.3
65 0.34
66 0.39
67 0.46
68 0.48
69 0.47
70 0.54
71 0.55
72 0.56
73 0.52
74 0.48
75 0.49
76 0.47
77 0.47
78 0.46
79 0.46
80 0.49
81 0.49
82 0.51
83 0.48
84 0.41
85 0.41
86 0.36
87 0.42
88 0.4
89 0.44
90 0.37
91 0.33
92 0.33
93 0.28
94 0.26
95 0.18
96 0.15
97 0.1
98 0.09
99 0.08
100 0.07
101 0.06
102 0.05
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.07
109 0.11
110 0.19
111 0.23
112 0.31
113 0.37
114 0.45
115 0.53
116 0.55
117 0.6
118 0.58
119 0.62
120 0.65
121 0.7
122 0.71
123 0.73
124 0.79
125 0.79
126 0.78
127 0.8
128 0.82
129 0.81
130 0.82
131 0.81
132 0.81
133 0.78
134 0.82
135 0.78
136 0.76
137 0.73
138 0.7
139 0.66
140 0.56
141 0.5
142 0.44
143 0.41
144 0.37
145 0.38
146 0.35
147 0.3
148 0.32