Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F478

Protein Details
Accession A7F478   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-32SPPCAGAKKGNVRAKPKKKGRYTDVMAHydrophilic
NLS Segment(s)
PositionSequence
13-26KKGNVRAKPKKKGR
Subcellular Location(s) cyto 13, cyto_nucl 9.833, cyto_mito 9.499, mito 4.5, pero 4, nucl 3.5
Family & Domain DBs
KEGG ssl:SS1G_12400  -  
Amino Acid Sequences MDGLLSPPCAGAKKGNVRAKPKKKGRYTDVMAGEGKSDKLGRKEGIYQKGKNELKVEFCLLLICICTIYAYAAKIPGGQQDYCII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.57
4 0.65
5 0.75
6 0.8
7 0.82
8 0.82
9 0.83
10 0.84
11 0.86
12 0.82
13 0.81
14 0.76
15 0.73
16 0.65
17 0.58
18 0.49
19 0.4
20 0.34
21 0.25
22 0.2
23 0.12
24 0.12
25 0.11
26 0.13
27 0.16
28 0.16
29 0.17
30 0.25
31 0.31
32 0.38
33 0.42
34 0.41
35 0.41
36 0.5
37 0.5
38 0.45
39 0.41
40 0.34
41 0.32
42 0.32
43 0.31
44 0.21
45 0.2
46 0.18
47 0.15
48 0.13
49 0.1
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.07
56 0.08
57 0.09
58 0.09
59 0.11
60 0.11
61 0.12
62 0.13
63 0.18
64 0.2
65 0.19