Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F0I0X1

Protein Details
Accession A0A0F0I0X1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MANQRLQYRRRNPYNTRSNKVRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MANQRLQYRRRNPYNTRSNKVRIIKTPGGELRYLHIKKKGTAPKCGDCGIKLPGVPALRPREYSQISRPKKTVTRAYGGSRCAGCVKDRIVRAFLIEEQKIVKKVLKESQEKAAGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.83
4 0.8
5 0.76
6 0.76
7 0.75
8 0.71
9 0.67
10 0.67
11 0.64
12 0.57
13 0.59
14 0.53
15 0.48
16 0.42
17 0.36
18 0.3
19 0.35
20 0.35
21 0.31
22 0.33
23 0.33
24 0.34
25 0.43
26 0.49
27 0.43
28 0.5
29 0.53
30 0.52
31 0.53
32 0.54
33 0.45
34 0.36
35 0.35
36 0.28
37 0.23
38 0.18
39 0.15
40 0.16
41 0.16
42 0.15
43 0.18
44 0.21
45 0.21
46 0.23
47 0.24
48 0.27
49 0.29
50 0.32
51 0.35
52 0.4
53 0.44
54 0.46
55 0.45
56 0.44
57 0.47
58 0.5
59 0.5
60 0.44
61 0.45
62 0.46
63 0.51
64 0.5
65 0.46
66 0.43
67 0.34
68 0.31
69 0.27
70 0.25
71 0.19
72 0.2
73 0.22
74 0.24
75 0.28
76 0.29
77 0.29
78 0.28
79 0.28
80 0.27
81 0.27
82 0.28
83 0.24
84 0.23
85 0.24
86 0.27
87 0.27
88 0.27
89 0.26
90 0.24
91 0.31
92 0.38
93 0.44
94 0.47
95 0.49
96 0.56
97 0.62