Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F8E7

Protein Details
Accession A7F8E7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-102QKIPTPRKWFRPRSIKRMMVHydrophilic
NLS Segment(s)
PositionSequence
82-95GQKIPTPRKWFRPR
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG ssl:SS1G_13878  -  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
Amino Acid Sequences MAAPLAAVARAPKMGRKEIFLPNFTITLLRTPNLPPSFASFIVPLNLNKLDMRDYLWNAYGIEVRAVRSYIQAQKLKEGKSGQKIPTPRKWFRPRSIKRMMVEMERPFVWPEEPKDFSPYVVTLEGFVFMVGKWMVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.35
4 0.4
5 0.47
6 0.51
7 0.48
8 0.46
9 0.4
10 0.38
11 0.34
12 0.29
13 0.2
14 0.19
15 0.19
16 0.15
17 0.15
18 0.16
19 0.25
20 0.25
21 0.25
22 0.21
23 0.25
24 0.29
25 0.27
26 0.27
27 0.19
28 0.19
29 0.19
30 0.2
31 0.14
32 0.14
33 0.14
34 0.13
35 0.13
36 0.13
37 0.14
38 0.12
39 0.15
40 0.14
41 0.15
42 0.16
43 0.16
44 0.16
45 0.14
46 0.14
47 0.13
48 0.1
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.12
57 0.15
58 0.22
59 0.25
60 0.25
61 0.31
62 0.36
63 0.35
64 0.36
65 0.36
66 0.34
67 0.39
68 0.45
69 0.41
70 0.41
71 0.47
72 0.5
73 0.56
74 0.59
75 0.56
76 0.6
77 0.68
78 0.72
79 0.75
80 0.79
81 0.77
82 0.78
83 0.83
84 0.79
85 0.7
86 0.68
87 0.61
88 0.55
89 0.53
90 0.46
91 0.39
92 0.33
93 0.33
94 0.27
95 0.25
96 0.22
97 0.2
98 0.23
99 0.27
100 0.31
101 0.31
102 0.35
103 0.34
104 0.33
105 0.31
106 0.27
107 0.23
108 0.21
109 0.19
110 0.15
111 0.15
112 0.15
113 0.12
114 0.11
115 0.08
116 0.07
117 0.1