Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F639

Protein Details
Accession A7F639    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-48DVHSIRKPFRNPHWRPNQRRNKNIKTILGDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG ssl:SS1G_13067  -  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MAPATPEAEAHQALIDQLDVHSIRKPFRNPHWRPNQRRNKNIKTILGDAVRKEASLMPTQDNSGAATPFSEDNTTSTDGDMTPAPTSAPMLQPNLAQASKNLSKLVLEKNMRTNGYSNAPTATYTNIESAPSLAHAKHYCDITGLPAPYTDPKTRLRYHNKEVFGVVRSLGQGVAEQYLEVRGAHTVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.07
4 0.06
5 0.1
6 0.11
7 0.12
8 0.16
9 0.19
10 0.23
11 0.3
12 0.36
13 0.4
14 0.5
15 0.61
16 0.63
17 0.71
18 0.78
19 0.82
20 0.86
21 0.89
22 0.89
23 0.88
24 0.92
25 0.91
26 0.9
27 0.89
28 0.86
29 0.81
30 0.75
31 0.68
32 0.63
33 0.58
34 0.5
35 0.41
36 0.38
37 0.31
38 0.25
39 0.23
40 0.2
41 0.18
42 0.2
43 0.21
44 0.2
45 0.2
46 0.21
47 0.21
48 0.18
49 0.16
50 0.13
51 0.11
52 0.08
53 0.08
54 0.08
55 0.08
56 0.09
57 0.08
58 0.07
59 0.08
60 0.11
61 0.13
62 0.12
63 0.12
64 0.12
65 0.11
66 0.12
67 0.11
68 0.09
69 0.07
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.09
76 0.1
77 0.1
78 0.11
79 0.11
80 0.12
81 0.14
82 0.13
83 0.1
84 0.09
85 0.14
86 0.16
87 0.17
88 0.16
89 0.14
90 0.15
91 0.18
92 0.21
93 0.23
94 0.23
95 0.24
96 0.29
97 0.34
98 0.33
99 0.31
100 0.29
101 0.24
102 0.27
103 0.26
104 0.21
105 0.18
106 0.18
107 0.17
108 0.16
109 0.15
110 0.11
111 0.11
112 0.12
113 0.11
114 0.11
115 0.1
116 0.1
117 0.09
118 0.09
119 0.1
120 0.08
121 0.13
122 0.15
123 0.18
124 0.2
125 0.21
126 0.19
127 0.19
128 0.19
129 0.18
130 0.21
131 0.18
132 0.16
133 0.15
134 0.17
135 0.2
136 0.25
137 0.24
138 0.24
139 0.31
140 0.38
141 0.44
142 0.52
143 0.59
144 0.63
145 0.69
146 0.73
147 0.69
148 0.64
149 0.61
150 0.54
151 0.45
152 0.37
153 0.28
154 0.21
155 0.18
156 0.17
157 0.14
158 0.11
159 0.1
160 0.1
161 0.11
162 0.09
163 0.09
164 0.09
165 0.1
166 0.1
167 0.09
168 0.09
169 0.08