Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F0IHT2

Protein Details
Accession A0A0F0IHT2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-31EPNPNPKPNPQTTNKKNKNPVLFRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.5, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013097  Dabb  
IPR011008  Dimeric_a/b-barrel  
IPR044662  HS1/DABB1-like  
Pfam View protein in Pfam  
PF07876  Dabb  
PROSITE View protein in PROSITE  
PS51502  S_R_A_B_BARREL  
Amino Acid Sequences MPVYHIEPNPNPKPNPQTTNKKNKNPVLFRLKQGVTPAQLANWTKISQAMVGQIPGLRSLKTNPPLPISVPRAKGFDMGLVAVLDKKEDVAVYATHPAHLEVHKLREELCEDTLAYDLEFEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.64
4 0.67
5 0.7
6 0.8
7 0.82
8 0.83
9 0.84
10 0.84
11 0.85
12 0.81
13 0.8
14 0.79
15 0.73
16 0.67
17 0.65
18 0.58
19 0.49
20 0.46
21 0.41
22 0.32
23 0.31
24 0.27
25 0.2
26 0.24
27 0.23
28 0.21
29 0.19
30 0.18
31 0.15
32 0.16
33 0.16
34 0.12
35 0.11
36 0.12
37 0.1
38 0.1
39 0.1
40 0.09
41 0.09
42 0.1
43 0.1
44 0.08
45 0.08
46 0.11
47 0.17
48 0.2
49 0.24
50 0.23
51 0.25
52 0.26
53 0.27
54 0.31
55 0.3
56 0.32
57 0.32
58 0.32
59 0.31
60 0.3
61 0.3
62 0.24
63 0.19
64 0.14
65 0.11
66 0.1
67 0.08
68 0.08
69 0.07
70 0.07
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.09
80 0.16
81 0.15
82 0.16
83 0.16
84 0.16
85 0.18
86 0.18
87 0.23
88 0.2
89 0.25
90 0.27
91 0.28
92 0.27
93 0.29
94 0.31
95 0.28
96 0.25
97 0.22
98 0.19
99 0.2
100 0.2
101 0.17
102 0.13