Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EAM8

Protein Details
Accession A7EAM8   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-59INLWNLRRTNPKLRGRTTKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, pero 4
Family & Domain DBs
KEGG ssl:SS1G_02360  -  
Amino Acid Sequences MYITYCMGALLGIQPSIVTNPWMILKFYMKREIEKAPNLINLWNLRRTNPKLRGRTTKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.07
6 0.06
7 0.07
8 0.1
9 0.11
10 0.11
11 0.11
12 0.15
13 0.18
14 0.21
15 0.28
16 0.26
17 0.27
18 0.3
19 0.34
20 0.34
21 0.34
22 0.34
23 0.28
24 0.31
25 0.3
26 0.27
27 0.26
28 0.26
29 0.26
30 0.3
31 0.29
32 0.3
33 0.38
34 0.45
35 0.51
36 0.56
37 0.63
38 0.65
39 0.73