Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EZR2

Protein Details
Accession A7EZR2    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-90LKAVPKKKTSHMKKRHRQMAGKGBasic
NLS Segment(s)
PositionSequence
72-84PKKKTSHMKKRHR
Subcellular Location(s) mito 19, cyto_mito 11.333, mito_nucl 11.333, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ssl:SS1G_10829  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MASVHTTTSSILSSFLPRLAPTTATFATRSTTLYSRQLSHPLLPVLTIPSAIHLNIPGFLEGLWEGILKAVPKKKTSHMKKRHRQMAGKGLQDVTNLNRCSACGHIKRAHLLCPYCVAGKEFLDGIAQGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.14
5 0.17
6 0.17
7 0.18
8 0.16
9 0.21
10 0.2
11 0.21
12 0.22
13 0.2
14 0.2
15 0.19
16 0.19
17 0.16
18 0.18
19 0.19
20 0.25
21 0.27
22 0.27
23 0.29
24 0.33
25 0.32
26 0.32
27 0.31
28 0.26
29 0.23
30 0.21
31 0.19
32 0.14
33 0.12
34 0.11
35 0.07
36 0.08
37 0.09
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.09
57 0.13
58 0.16
59 0.19
60 0.21
61 0.29
62 0.39
63 0.5
64 0.57
65 0.63
66 0.72
67 0.79
68 0.87
69 0.88
70 0.85
71 0.81
72 0.78
73 0.77
74 0.73
75 0.66
76 0.57
77 0.49
78 0.42
79 0.36
80 0.3
81 0.23
82 0.24
83 0.22
84 0.21
85 0.2
86 0.2
87 0.21
88 0.24
89 0.29
90 0.26
91 0.33
92 0.38
93 0.41
94 0.48
95 0.48
96 0.49
97 0.48
98 0.45
99 0.39
100 0.38
101 0.37
102 0.32
103 0.31
104 0.27
105 0.23
106 0.22
107 0.22
108 0.18
109 0.16
110 0.15
111 0.14