Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F0IH01

Protein Details
Accession A0A0F0IH01    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-107IEKVKKEYEERQKKKKDKSKEKKSDEESKKEBasic
NLS Segment(s)
PositionSequence
66-106KKKKEEALAKEIEKVKKEYEERQKKKKDKSKEKKSDEESKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSGPFQNIYHLRRVADTAAKACYVCHKPSSSVMITPDNKDFFYVCPIHLKDRHFCSPIVDTEAEEKKKKEEALAKEIEKVKKEYEERQKKKKDKSKEKKSDEESKKEEKPSNTDKQEGNDEKERDNKVYTLPYLPCPFSLRPSIRSDPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.28
5 0.28
6 0.28
7 0.26
8 0.24
9 0.28
10 0.27
11 0.27
12 0.29
13 0.3
14 0.31
15 0.35
16 0.41
17 0.34
18 0.32
19 0.32
20 0.36
21 0.36
22 0.36
23 0.36
24 0.31
25 0.3
26 0.28
27 0.25
28 0.18
29 0.21
30 0.2
31 0.16
32 0.22
33 0.24
34 0.29
35 0.32
36 0.35
37 0.34
38 0.4
39 0.44
40 0.39
41 0.38
42 0.35
43 0.34
44 0.32
45 0.3
46 0.23
47 0.19
48 0.22
49 0.28
50 0.27
51 0.26
52 0.25
53 0.23
54 0.26
55 0.26
56 0.25
57 0.28
58 0.3
59 0.35
60 0.39
61 0.37
62 0.39
63 0.43
64 0.41
65 0.35
66 0.31
67 0.26
68 0.27
69 0.3
70 0.34
71 0.4
72 0.49
73 0.55
74 0.64
75 0.73
76 0.75
77 0.83
78 0.83
79 0.83
80 0.83
81 0.87
82 0.88
83 0.89
84 0.89
85 0.87
86 0.86
87 0.85
88 0.82
89 0.79
90 0.74
91 0.7
92 0.68
93 0.65
94 0.64
95 0.56
96 0.56
97 0.56
98 0.6
99 0.56
100 0.56
101 0.51
102 0.49
103 0.56
104 0.52
105 0.5
106 0.48
107 0.46
108 0.45
109 0.5
110 0.5
111 0.42
112 0.41
113 0.35
114 0.31
115 0.34
116 0.33
117 0.32
118 0.31
119 0.35
120 0.37
121 0.37
122 0.35
123 0.35
124 0.35
125 0.33
126 0.41
127 0.39
128 0.39
129 0.46