Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E623

Protein Details
Accession A7E623    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
112-137PASTKKGAGKKKATGKKKKIEDEGLTBasic
NLS Segment(s)
PositionSequence
103-130RETKREGSVPASTKKGAGKKKATGKKKK
Subcellular Location(s) nucl 14.5, cyto_nucl 12.333, cyto 9, cyto_mito 6.333
Family & Domain DBs
KEGG ssl:SS1G_00748  -  
Amino Acid Sequences MPPKKVSLKLDNNTLVRTAVTNQINLADEFKQIWNKLDHDRFIEDMGVGNRNAASKRYKRWAAGIVKSSVKSHGYDTDTTDTEHKIEPTEKAVKEVCAPPTKRETKREGSVPASTKKGAGKKKATGKKKKIEDEGLTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.4
3 0.3
4 0.27
5 0.21
6 0.21
7 0.21
8 0.2
9 0.2
10 0.21
11 0.22
12 0.21
13 0.21
14 0.14
15 0.13
16 0.15
17 0.17
18 0.19
19 0.19
20 0.22
21 0.23
22 0.25
23 0.33
24 0.36
25 0.35
26 0.34
27 0.35
28 0.32
29 0.3
30 0.27
31 0.18
32 0.16
33 0.15
34 0.14
35 0.12
36 0.11
37 0.11
38 0.12
39 0.12
40 0.12
41 0.19
42 0.22
43 0.27
44 0.35
45 0.38
46 0.38
47 0.41
48 0.46
49 0.45
50 0.45
51 0.43
52 0.38
53 0.36
54 0.36
55 0.33
56 0.26
57 0.21
58 0.17
59 0.15
60 0.17
61 0.18
62 0.18
63 0.21
64 0.22
65 0.21
66 0.21
67 0.21
68 0.16
69 0.15
70 0.15
71 0.13
72 0.12
73 0.13
74 0.13
75 0.17
76 0.24
77 0.23
78 0.25
79 0.25
80 0.24
81 0.27
82 0.29
83 0.29
84 0.31
85 0.33
86 0.33
87 0.42
88 0.51
89 0.53
90 0.56
91 0.59
92 0.58
93 0.63
94 0.64
95 0.6
96 0.56
97 0.56
98 0.55
99 0.51
100 0.47
101 0.41
102 0.38
103 0.39
104 0.43
105 0.45
106 0.49
107 0.52
108 0.58
109 0.68
110 0.75
111 0.79
112 0.82
113 0.84
114 0.85
115 0.87
116 0.88
117 0.86
118 0.85
119 0.8