Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F0IEW3

Protein Details
Accession A0A0F0IEW3    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
194-213ISSGRRDWEEKKRERERDRPBasic
NLS Segment(s)
PositionSequence
139-155KEGERRGGRSARDLPPR
203-213EKKRERERDRP
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08312  cwf21  
CDD cd21372  cwf21_CWC21-like  
Amino Acid Sequences MSSNVGLNTPRGSGTSGYVQKNWAFMKPRNAGYGAPYPPVGANSDAGRPFKQRLPDKQILEHDRRRAIEVKVMEERDRLEEENERIEEELAQRKKKGDKEDGEEQEGNILSDEEIEERCEALRERLVKEMEEEEESKGKEGERRGGRSARDLPPRDRKQFKSYQVHELAEAKIEESERLRKALGIKEDKETGEISSGRRDWEEKKRERERDRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.3
4 0.32
5 0.33
6 0.36
7 0.35
8 0.39
9 0.37
10 0.35
11 0.34
12 0.36
13 0.45
14 0.48
15 0.49
16 0.47
17 0.47
18 0.41
19 0.4
20 0.43
21 0.35
22 0.3
23 0.27
24 0.25
25 0.23
26 0.24
27 0.2
28 0.14
29 0.14
30 0.14
31 0.18
32 0.2
33 0.22
34 0.23
35 0.24
36 0.26
37 0.28
38 0.36
39 0.4
40 0.46
41 0.54
42 0.6
43 0.6
44 0.62
45 0.67
46 0.65
47 0.65
48 0.62
49 0.58
50 0.55
51 0.53
52 0.5
53 0.46
54 0.4
55 0.37
56 0.33
57 0.32
58 0.32
59 0.33
60 0.3
61 0.27
62 0.26
63 0.23
64 0.23
65 0.2
66 0.16
67 0.19
68 0.19
69 0.22
70 0.21
71 0.19
72 0.17
73 0.16
74 0.15
75 0.14
76 0.21
77 0.22
78 0.23
79 0.24
80 0.27
81 0.33
82 0.37
83 0.42
84 0.42
85 0.43
86 0.47
87 0.55
88 0.55
89 0.53
90 0.48
91 0.4
92 0.33
93 0.28
94 0.21
95 0.12
96 0.09
97 0.05
98 0.05
99 0.05
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.07
108 0.08
109 0.12
110 0.14
111 0.15
112 0.2
113 0.21
114 0.2
115 0.21
116 0.21
117 0.19
118 0.18
119 0.18
120 0.15
121 0.17
122 0.17
123 0.16
124 0.15
125 0.14
126 0.16
127 0.17
128 0.25
129 0.28
130 0.33
131 0.37
132 0.41
133 0.41
134 0.44
135 0.49
136 0.48
137 0.51
138 0.51
139 0.54
140 0.61
141 0.68
142 0.7
143 0.71
144 0.69
145 0.68
146 0.72
147 0.74
148 0.74
149 0.69
150 0.7
151 0.67
152 0.62
153 0.56
154 0.49
155 0.4
156 0.32
157 0.28
158 0.19
159 0.15
160 0.15
161 0.14
162 0.15
163 0.22
164 0.21
165 0.22
166 0.22
167 0.23
168 0.28
169 0.33
170 0.39
171 0.4
172 0.41
173 0.44
174 0.47
175 0.45
176 0.42
177 0.36
178 0.27
179 0.24
180 0.24
181 0.21
182 0.25
183 0.26
184 0.26
185 0.28
186 0.31
187 0.34
188 0.43
189 0.52
190 0.53
191 0.63
192 0.72
193 0.8