Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EY03

Protein Details
Accession A7EY03    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-139TTPRVRGKPGPKKKARLDDGBasic
176-196LDRSGKPCRKWEKRSFIIKTFHydrophilic
NLS Segment(s)
PositionSequence
104-109KKGGVK
122-135PRVRGKPGPKKKAR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG ssl:SS1G_10218  -  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MASASKPTSTTSAPRRKSSGPKEKNTMIITLKLSPEKLRSVGQPLIKEDTPSKDSTSTIPTTIPVATSQNGDAPAESNSNTPAPNGTATPAPSSMPPPTEAIKKKGGVKRSSTAALGSDTTPRVRGKPGPKKKARLDDGTIDPTGNTPRAPNGNGTSHRLGPKANQGAINAGLRALDRSGKPCRKWEKRSFIIKTFTGIPIEIPRWRAPPKVAINHSTEGSSTGDSSKENKENSQVESEKSNSAMDIDATHLASSPAPAPAPAPALTPALAPAPQAEAKAQAQEQPSAVITASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.64
4 0.71
5 0.74
6 0.74
7 0.74
8 0.76
9 0.79
10 0.77
11 0.77
12 0.68
13 0.62
14 0.54
15 0.49
16 0.43
17 0.39
18 0.38
19 0.34
20 0.34
21 0.31
22 0.32
23 0.31
24 0.31
25 0.3
26 0.3
27 0.34
28 0.38
29 0.39
30 0.39
31 0.38
32 0.42
33 0.39
34 0.38
35 0.35
36 0.35
37 0.34
38 0.32
39 0.31
40 0.27
41 0.27
42 0.28
43 0.3
44 0.26
45 0.23
46 0.22
47 0.2
48 0.2
49 0.19
50 0.17
51 0.13
52 0.13
53 0.13
54 0.14
55 0.14
56 0.15
57 0.15
58 0.15
59 0.13
60 0.12
61 0.12
62 0.12
63 0.12
64 0.11
65 0.12
66 0.13
67 0.13
68 0.12
69 0.12
70 0.12
71 0.12
72 0.12
73 0.12
74 0.12
75 0.13
76 0.15
77 0.14
78 0.13
79 0.13
80 0.15
81 0.16
82 0.15
83 0.15
84 0.16
85 0.18
86 0.25
87 0.28
88 0.3
89 0.33
90 0.35
91 0.42
92 0.44
93 0.5
94 0.47
95 0.48
96 0.47
97 0.46
98 0.44
99 0.36
100 0.32
101 0.25
102 0.21
103 0.17
104 0.14
105 0.13
106 0.12
107 0.12
108 0.14
109 0.14
110 0.14
111 0.17
112 0.23
113 0.32
114 0.42
115 0.52
116 0.6
117 0.66
118 0.73
119 0.77
120 0.8
121 0.75
122 0.69
123 0.62
124 0.57
125 0.53
126 0.47
127 0.4
128 0.3
129 0.25
130 0.2
131 0.18
132 0.13
133 0.1
134 0.07
135 0.09
136 0.11
137 0.12
138 0.14
139 0.16
140 0.21
141 0.22
142 0.27
143 0.27
144 0.27
145 0.28
146 0.27
147 0.24
148 0.21
149 0.27
150 0.26
151 0.26
152 0.24
153 0.23
154 0.24
155 0.25
156 0.23
157 0.15
158 0.11
159 0.09
160 0.08
161 0.08
162 0.07
163 0.09
164 0.09
165 0.14
166 0.24
167 0.3
168 0.33
169 0.41
170 0.51
171 0.58
172 0.67
173 0.73
174 0.74
175 0.76
176 0.84
177 0.8
178 0.76
179 0.71
180 0.61
181 0.53
182 0.46
183 0.38
184 0.29
185 0.23
186 0.18
187 0.17
188 0.19
189 0.18
190 0.19
191 0.2
192 0.25
193 0.27
194 0.29
195 0.28
196 0.34
197 0.4
198 0.46
199 0.48
200 0.47
201 0.49
202 0.48
203 0.46
204 0.37
205 0.29
206 0.22
207 0.2
208 0.16
209 0.12
210 0.11
211 0.11
212 0.12
213 0.15
214 0.21
215 0.25
216 0.26
217 0.27
218 0.34
219 0.36
220 0.38
221 0.42
222 0.37
223 0.34
224 0.36
225 0.36
226 0.3
227 0.28
228 0.26
229 0.17
230 0.16
231 0.15
232 0.11
233 0.1
234 0.11
235 0.11
236 0.11
237 0.11
238 0.11
239 0.11
240 0.1
241 0.11
242 0.1
243 0.1
244 0.1
245 0.1
246 0.1
247 0.12
248 0.15
249 0.14
250 0.14
251 0.15
252 0.16
253 0.16
254 0.16
255 0.15
256 0.14
257 0.13
258 0.12
259 0.11
260 0.14
261 0.15
262 0.16
263 0.16
264 0.19
265 0.2
266 0.24
267 0.24
268 0.25
269 0.26
270 0.27
271 0.27
272 0.25
273 0.24
274 0.2