Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F0I7T4

Protein Details
Accession A0A0F0I7T4   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-99HYNNHSRRHSRGPRRTMRYSRDBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.333, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MVSTGEAVYMTPYSPYPSHHQLDSDLNMNSSCCRFLSSSPSRQSLRRQRSSSIPSICFDGYLEHLPVEPKKKRECTSHYNNHSRRHSRGPRRTMRYSRDSQLVNPDIIDRLDSASFFQYHHEGPYDAVYPERNFDSKLSPIEAVKRTNEEALKATPEDKIKDSINSHRPLDGVAFYPPGTTDREGQTYNYEEGTNMMNDYGNFMRCPGLKFTEEDFKNDPFYNTPLPKPFASLRRVLSLRRRNRRSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.24
4 0.32
5 0.35
6 0.35
7 0.36
8 0.35
9 0.4
10 0.39
11 0.35
12 0.28
13 0.26
14 0.24
15 0.23
16 0.22
17 0.18
18 0.16
19 0.12
20 0.14
21 0.15
22 0.17
23 0.27
24 0.33
25 0.41
26 0.45
27 0.51
28 0.5
29 0.53
30 0.61
31 0.62
32 0.64
33 0.65
34 0.63
35 0.61
36 0.68
37 0.7
38 0.68
39 0.65
40 0.56
41 0.47
42 0.47
43 0.43
44 0.34
45 0.27
46 0.2
47 0.16
48 0.16
49 0.16
50 0.12
51 0.13
52 0.15
53 0.19
54 0.26
55 0.28
56 0.33
57 0.4
58 0.48
59 0.52
60 0.59
61 0.63
62 0.63
63 0.69
64 0.73
65 0.74
66 0.77
67 0.78
68 0.78
69 0.79
70 0.75
71 0.69
72 0.7
73 0.71
74 0.71
75 0.75
76 0.77
77 0.77
78 0.8
79 0.85
80 0.82
81 0.78
82 0.75
83 0.7
84 0.63
85 0.58
86 0.51
87 0.43
88 0.43
89 0.38
90 0.3
91 0.25
92 0.22
93 0.18
94 0.17
95 0.15
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.09
103 0.08
104 0.09
105 0.1
106 0.1
107 0.11
108 0.11
109 0.1
110 0.1
111 0.11
112 0.11
113 0.09
114 0.09
115 0.1
116 0.09
117 0.1
118 0.11
119 0.1
120 0.1
121 0.11
122 0.14
123 0.14
124 0.15
125 0.16
126 0.15
127 0.16
128 0.21
129 0.23
130 0.22
131 0.21
132 0.22
133 0.22
134 0.24
135 0.24
136 0.2
137 0.19
138 0.18
139 0.19
140 0.17
141 0.16
142 0.16
143 0.18
144 0.19
145 0.18
146 0.2
147 0.19
148 0.23
149 0.26
150 0.31
151 0.37
152 0.39
153 0.38
154 0.36
155 0.35
156 0.31
157 0.29
158 0.21
159 0.15
160 0.12
161 0.12
162 0.11
163 0.11
164 0.11
165 0.11
166 0.13
167 0.13
168 0.15
169 0.17
170 0.2
171 0.21
172 0.22
173 0.24
174 0.24
175 0.24
176 0.22
177 0.19
178 0.16
179 0.16
180 0.17
181 0.13
182 0.1
183 0.09
184 0.09
185 0.09
186 0.13
187 0.14
188 0.14
189 0.13
190 0.14
191 0.17
192 0.18
193 0.21
194 0.21
195 0.24
196 0.24
197 0.27
198 0.3
199 0.37
200 0.36
201 0.38
202 0.37
203 0.35
204 0.37
205 0.36
206 0.34
207 0.27
208 0.31
209 0.34
210 0.35
211 0.39
212 0.4
213 0.43
214 0.41
215 0.44
216 0.46
217 0.45
218 0.46
219 0.46
220 0.44
221 0.49
222 0.51
223 0.53
224 0.57
225 0.6
226 0.66
227 0.71
228 0.75