Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E8I7

Protein Details
Accession A7E8I7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-127ANEALSKRRRARKVLIRKEGAFHydrophilic
NLS Segment(s)
PositionSequence
111-122SKRRRARKVLIR
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
KEGG ssl:SS1G_01615  -  
Pfam View protein in Pfam  
PF05225  HTH_psq  
Amino Acid Sequences MQESQINLAIQAIASSKKLSVRRAAKIYNIPTKRTRKRLALLQSQTPHNPTEVLSQSTLVKSRIARHQGSLPTPIFETIAALAKDIELLVYANTFLTTEVHNLRKANEALSKRRRARKVLIRKEGAFSIEDGHGILE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.18
5 0.23
6 0.27
7 0.35
8 0.41
9 0.48
10 0.54
11 0.55
12 0.55
13 0.58
14 0.61
15 0.62
16 0.58
17 0.55
18 0.57
19 0.65
20 0.68
21 0.69
22 0.68
23 0.66
24 0.69
25 0.72
26 0.72
27 0.72
28 0.67
29 0.65
30 0.61
31 0.57
32 0.52
33 0.45
34 0.37
35 0.27
36 0.24
37 0.17
38 0.19
39 0.18
40 0.18
41 0.17
42 0.17
43 0.18
44 0.18
45 0.19
46 0.14
47 0.14
48 0.13
49 0.17
50 0.23
51 0.28
52 0.28
53 0.28
54 0.32
55 0.33
56 0.32
57 0.33
58 0.26
59 0.21
60 0.21
61 0.19
62 0.15
63 0.12
64 0.1
65 0.06
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.09
86 0.14
87 0.17
88 0.2
89 0.21
90 0.22
91 0.27
92 0.27
93 0.27
94 0.3
95 0.34
96 0.41
97 0.5
98 0.59
99 0.61
100 0.7
101 0.73
102 0.73
103 0.77
104 0.78
105 0.8
106 0.81
107 0.82
108 0.8
109 0.75
110 0.72
111 0.64
112 0.55
113 0.44
114 0.34
115 0.27
116 0.2
117 0.18