Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F0HYE0

Protein Details
Accession A0A0F0HYE0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
171-192DREQRVRELRKLRKKLENVLGAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, nucl 7.5, cyto 6.5, mito 6, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR021384  Mediator_Med21  
Gene Ontology GO:0016592  C:mediator complex  
Pfam View protein in Pfam  
PF11221  Med21  
Amino Acid Sequences MADILTQLQTCLDQLATQFYATIGYLVTYHDNSPAIPPQNDPTAAPALAKITKNSTAPPVPAGAPAGSQASPQQQSAQIPGQQQQGGGDAGQTPGAGGGTGGTGADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIKELEKELRSAEEDREQRVRELRKLRKKLENVLGAVEVGIYGDRGVVASRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.15
4 0.14
5 0.14
6 0.13
7 0.14
8 0.12
9 0.12
10 0.07
11 0.06
12 0.06
13 0.08
14 0.11
15 0.11
16 0.12
17 0.13
18 0.14
19 0.14
20 0.17
21 0.22
22 0.24
23 0.23
24 0.25
25 0.26
26 0.3
27 0.3
28 0.27
29 0.25
30 0.23
31 0.22
32 0.2
33 0.17
34 0.16
35 0.2
36 0.2
37 0.18
38 0.19
39 0.22
40 0.23
41 0.24
42 0.27
43 0.25
44 0.25
45 0.24
46 0.22
47 0.19
48 0.19
49 0.19
50 0.13
51 0.11
52 0.11
53 0.11
54 0.09
55 0.09
56 0.1
57 0.14
58 0.15
59 0.15
60 0.16
61 0.16
62 0.17
63 0.2
64 0.21
65 0.2
66 0.2
67 0.23
68 0.25
69 0.23
70 0.22
71 0.19
72 0.17
73 0.14
74 0.12
75 0.09
76 0.06
77 0.06
78 0.06
79 0.06
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.02
87 0.03
88 0.02
89 0.02
90 0.02
91 0.03
92 0.04
93 0.04
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.13
100 0.17
101 0.19
102 0.2
103 0.23
104 0.27
105 0.28
106 0.34
107 0.36
108 0.37
109 0.39
110 0.41
111 0.4
112 0.38
113 0.39
114 0.35
115 0.3
116 0.26
117 0.26
118 0.24
119 0.22
120 0.21
121 0.19
122 0.16
123 0.15
124 0.14
125 0.1
126 0.09
127 0.09
128 0.07
129 0.07
130 0.06
131 0.05
132 0.04
133 0.05
134 0.04
135 0.04
136 0.05
137 0.11
138 0.12
139 0.12
140 0.16
141 0.2
142 0.21
143 0.23
144 0.23
145 0.21
146 0.24
147 0.34
148 0.4
149 0.39
150 0.4
151 0.39
152 0.4
153 0.41
154 0.38
155 0.31
156 0.31
157 0.3
158 0.32
159 0.37
160 0.36
161 0.37
162 0.43
163 0.45
164 0.46
165 0.54
166 0.6
167 0.65
168 0.73
169 0.78
170 0.8
171 0.81
172 0.82
173 0.81
174 0.77
175 0.68
176 0.61
177 0.53
178 0.43
179 0.36
180 0.26
181 0.16
182 0.09
183 0.07
184 0.05
185 0.04
186 0.04
187 0.04
188 0.05