Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2RRD3

Protein Details
Accession W2RRD3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LLWYRPWRLSPPQKARQRKRLKLVDQVVHydrophilic
78-99FDRKEKSYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 13.333, cyto_nucl 2.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFRPTQRLLGGLLWYRPWRLSPPQKARQRKRLKLVDQVVDTVSAALQKGGMSSKAIDRWYSEMPREEQMLPRDKYTIFDRKEKSYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.24
4 0.24
5 0.25
6 0.32
7 0.41
8 0.48
9 0.57
10 0.65
11 0.75
12 0.84
13 0.88
14 0.88
15 0.89
16 0.87
17 0.87
18 0.87
19 0.82
20 0.81
21 0.78
22 0.73
23 0.63
24 0.55
25 0.45
26 0.35
27 0.3
28 0.19
29 0.13
30 0.07
31 0.06
32 0.05
33 0.04
34 0.04
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.08
41 0.11
42 0.12
43 0.11
44 0.12
45 0.15
46 0.19
47 0.2
48 0.2
49 0.21
50 0.22
51 0.23
52 0.25
53 0.22
54 0.23
55 0.27
56 0.33
57 0.31
58 0.3
59 0.3
60 0.28
61 0.3
62 0.32
63 0.36
64 0.31
65 0.38
66 0.41
67 0.48
68 0.57
69 0.61
70 0.6
71 0.61
72 0.66
73 0.67
74 0.73
75 0.74
76 0.76
77 0.77
78 0.82
79 0.82
80 0.83
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79