Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F1H2

Protein Details
Accession A7F1H2    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
159-184KTGAGEKKKPKAAAKKGKKIKLSFGDBasic
NLS Segment(s)
PositionSequence
127-131KKRKV
159-179KTGAGEKKKPKAAAKKGKKIK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
KEGG ssl:SS1G_11442  -  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSKITPKNLSYNNTLPPFLQRLQANSSSSNGRHEFSISRPSKPRDEDEEKESEPVVFDEVSGETLSKEEWERREKEREEKEEGEGKDGEGDAEGEEKGKEGKETAVNGKIGGVGTGIGSGIGIGAGKKRKVGKIIGGSEGEEEERTDNGSEKQKEESTKTGAGEKKKPKAAAKKGKKIKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.4
4 0.41
5 0.35
6 0.36
7 0.29
8 0.3
9 0.36
10 0.4
11 0.37
12 0.33
13 0.34
14 0.33
15 0.32
16 0.35
17 0.31
18 0.27
19 0.25
20 0.26
21 0.26
22 0.24
23 0.34
24 0.3
25 0.34
26 0.4
27 0.44
28 0.49
29 0.51
30 0.53
31 0.52
32 0.58
33 0.56
34 0.54
35 0.55
36 0.48
37 0.45
38 0.39
39 0.3
40 0.22
41 0.18
42 0.14
43 0.08
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.08
55 0.11
56 0.16
57 0.22
58 0.26
59 0.31
60 0.39
61 0.41
62 0.49
63 0.54
64 0.54
65 0.54
66 0.52
67 0.51
68 0.49
69 0.46
70 0.4
71 0.31
72 0.26
73 0.2
74 0.18
75 0.14
76 0.07
77 0.07
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.05
86 0.06
87 0.05
88 0.08
89 0.1
90 0.13
91 0.16
92 0.18
93 0.18
94 0.18
95 0.18
96 0.16
97 0.13
98 0.11
99 0.08
100 0.04
101 0.04
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.02
108 0.02
109 0.02
110 0.03
111 0.07
112 0.11
113 0.11
114 0.16
115 0.2
116 0.23
117 0.27
118 0.31
119 0.35
120 0.4
121 0.43
122 0.42
123 0.39
124 0.36
125 0.33
126 0.3
127 0.22
128 0.14
129 0.11
130 0.09
131 0.08
132 0.09
133 0.1
134 0.11
135 0.15
136 0.24
137 0.26
138 0.26
139 0.31
140 0.34
141 0.38
142 0.41
143 0.41
144 0.38
145 0.39
146 0.38
147 0.41
148 0.42
149 0.45
150 0.5
151 0.54
152 0.58
153 0.61
154 0.66
155 0.68
156 0.74
157 0.78
158 0.8
159 0.82
160 0.84
161 0.87
162 0.89
163 0.88
164 0.82
165 0.81
166 0.79