Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2RYC1

Protein Details
Accession W2RYC1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-76LKAVPKKKTSHMKRRHRLLAGBasic
NLS Segment(s)
PositionSequence
60-77PKKKTSHMKRRHRLLAGK
Subcellular Location(s) mito 12, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAFSSALLRSGSLLDASRHALAAFNPLRTASVNIALPAAAISIPSLLSDIWEGILKAVPKKKTSHMKRRHRLLAGKAMKDVKSVVRCPGCGKPKKAHTLCPYCVAEIKQAWNDDKRASQTDLKEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.16
5 0.15
6 0.15
7 0.14
8 0.14
9 0.12
10 0.2
11 0.2
12 0.18
13 0.18
14 0.18
15 0.19
16 0.19
17 0.21
18 0.14
19 0.15
20 0.15
21 0.15
22 0.15
23 0.13
24 0.12
25 0.09
26 0.08
27 0.04
28 0.04
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.07
43 0.07
44 0.11
45 0.16
46 0.18
47 0.21
48 0.23
49 0.3
50 0.39
51 0.49
52 0.56
53 0.62
54 0.7
55 0.77
56 0.83
57 0.82
58 0.78
59 0.74
60 0.68
61 0.68
62 0.63
63 0.55
64 0.5
65 0.47
66 0.41
67 0.36
68 0.32
69 0.27
70 0.26
71 0.26
72 0.3
73 0.29
74 0.29
75 0.33
76 0.4
77 0.44
78 0.46
79 0.5
80 0.52
81 0.58
82 0.68
83 0.68
84 0.68
85 0.68
86 0.7
87 0.67
88 0.66
89 0.59
90 0.49
91 0.5
92 0.42
93 0.37
94 0.32
95 0.34
96 0.31
97 0.33
98 0.36
99 0.37
100 0.39
101 0.37
102 0.39
103 0.39
104 0.39
105 0.41
106 0.43