Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2SBP7

Protein Details
Accession W2SBP7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-24FSNTDHPSKKPKTSHPPPSASSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSFSNTDHPSKKPKTSHPPPSASSNSPYAEISIFDPVRTNTPETSPATLMEDTEVDLFPEGTSHAAPQTPPRNDHLNAAAPGELSPPRSQGNASADAVTGALNGNGPVSAGGANGAQEPGNMSSFTDSGNAGLSFAQQGYGGEYNGTNKNEKGPQPGEWKTKKAQDEMVRAWEFVVDREWSAQEYGDVIMAGRQQGTGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.83
4 0.82
5 0.82
6 0.76
7 0.76
8 0.72
9 0.64
10 0.57
11 0.51
12 0.43
13 0.38
14 0.35
15 0.28
16 0.22
17 0.2
18 0.17
19 0.2
20 0.18
21 0.17
22 0.19
23 0.19
24 0.22
25 0.24
26 0.25
27 0.19
28 0.22
29 0.27
30 0.27
31 0.3
32 0.26
33 0.24
34 0.25
35 0.23
36 0.21
37 0.16
38 0.14
39 0.11
40 0.12
41 0.11
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.07
53 0.08
54 0.15
55 0.24
56 0.26
57 0.28
58 0.31
59 0.36
60 0.36
61 0.38
62 0.34
63 0.3
64 0.27
65 0.26
66 0.22
67 0.17
68 0.16
69 0.15
70 0.12
71 0.1
72 0.1
73 0.11
74 0.12
75 0.12
76 0.12
77 0.15
78 0.18
79 0.19
80 0.19
81 0.17
82 0.16
83 0.16
84 0.16
85 0.11
86 0.08
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.04
104 0.04
105 0.06
106 0.06
107 0.07
108 0.07
109 0.07
110 0.08
111 0.08
112 0.09
113 0.08
114 0.07
115 0.07
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.08
127 0.09
128 0.09
129 0.09
130 0.09
131 0.13
132 0.18
133 0.19
134 0.18
135 0.18
136 0.23
137 0.29
138 0.31
139 0.35
140 0.33
141 0.37
142 0.44
143 0.51
144 0.56
145 0.54
146 0.57
147 0.54
148 0.59
149 0.57
150 0.52
151 0.54
152 0.52
153 0.56
154 0.55
155 0.58
156 0.51
157 0.47
158 0.43
159 0.37
160 0.29
161 0.22
162 0.21
163 0.14
164 0.13
165 0.15
166 0.16
167 0.15
168 0.16
169 0.15
170 0.12
171 0.12
172 0.11
173 0.1
174 0.09
175 0.08
176 0.09
177 0.1
178 0.1
179 0.1
180 0.09