Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EK79

Protein Details
Accession A7EK79    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-121RMIEGKEKGEKRKEKRERRKAERKRABasic
NLS Segment(s)
PositionSequence
100-121GKEKGEKRKEKRERRKAERKRA
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG ssl:SS1G_05725  -  
Amino Acid Sequences MVEKERELSERERNLEGKMEVVRWERRGVGLRRGFGDGMGMEMAMREEGGEMVRREMIKGEMEVEIKGSKGESRLEGSVLRSESNILEKERILEERMIEGKEKGEKRKEKRERRKAERKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.37
4 0.31
5 0.27
6 0.24
7 0.24
8 0.29
9 0.32
10 0.29
11 0.3
12 0.28
13 0.29
14 0.37
15 0.36
16 0.4
17 0.4
18 0.4
19 0.4
20 0.41
21 0.38
22 0.29
23 0.26
24 0.16
25 0.12
26 0.1
27 0.08
28 0.05
29 0.05
30 0.06
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.04
37 0.07
38 0.07
39 0.08
40 0.1
41 0.1
42 0.1
43 0.11
44 0.12
45 0.09
46 0.09
47 0.1
48 0.09
49 0.1
50 0.1
51 0.1
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.07
58 0.09
59 0.09
60 0.12
61 0.12
62 0.14
63 0.15
64 0.15
65 0.17
66 0.16
67 0.15
68 0.13
69 0.13
70 0.13
71 0.16
72 0.17
73 0.15
74 0.15
75 0.15
76 0.17
77 0.19
78 0.19
79 0.18
80 0.17
81 0.16
82 0.2
83 0.22
84 0.21
85 0.21
86 0.2
87 0.21
88 0.28
89 0.33
90 0.36
91 0.44
92 0.53
93 0.6
94 0.71
95 0.79
96 0.82
97 0.88
98 0.91
99 0.92
100 0.93
101 0.96