Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2S2U4

Protein Details
Accession W2S2U4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VSAKKHVPIVKKHRKSWFRHQSDRFKCVPSAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-16KKHRK
34-46RKPKGIDNRVRRR
Subcellular Location(s) mito 20.5, mito_nucl 11.833, cyto 4.5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKHRKSWFRHQSDRFKCVPSAWRKPKGIDNRVRRRFKGQMVMPSIGFGSNKKTRHMMPSGHKAFLVHNPKDVELLLMHNRTYAAEIAHAVSSKKRVEIIGKAKALGVKVTNPKARVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.84
4 0.85
5 0.85
6 0.83
7 0.84
8 0.86
9 0.86
10 0.85
11 0.83
12 0.75
13 0.67
14 0.58
15 0.52
16 0.52
17 0.5
18 0.54
19 0.57
20 0.62
21 0.61
22 0.63
23 0.68
24 0.69
25 0.7
26 0.68
27 0.7
28 0.72
29 0.8
30 0.83
31 0.76
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.32
62 0.35
63 0.36
64 0.26
65 0.28
66 0.29
67 0.29
68 0.29
69 0.27
70 0.2
71 0.12
72 0.15
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.15
80 0.12
81 0.08
82 0.08
83 0.09
84 0.1
85 0.1
86 0.11
87 0.1
88 0.12
89 0.16
90 0.17
91 0.17
92 0.18
93 0.19
94 0.23
95 0.32
96 0.38
97 0.42
98 0.42
99 0.41
100 0.41
101 0.4
102 0.36
103 0.3
104 0.25
105 0.24
106 0.31
107 0.39
108 0.43
109 0.43
110 0.45
111 0.46