Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ESW6

Protein Details
Accession A7ESW6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-67DDGSGSQRPRRRRRKCPVDEVGEQBasic
NLS Segment(s)
PositionSequence
52-57PRRRRR
Subcellular Location(s) E.R. 7, mito 6, extr 6, golg 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG ssl:SS1G_08421  -  
Amino Acid Sequences MPPHLHPRSKFTSSLFAGTLFASFFVVALPHVLPCPAPRVVYADDGSGSQRPRRRRRKCPVDEVGEQGQGQAQDQRVLKVQRGEREGVSGYKDFNEKVREEMGGSGESDDGEEIEGRRKAKRECPVPKPGGVLGGILGFKSSVDEKGSKPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.31
4 0.28
5 0.25
6 0.22
7 0.13
8 0.1
9 0.08
10 0.07
11 0.06
12 0.05
13 0.05
14 0.05
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.08
21 0.08
22 0.13
23 0.12
24 0.12
25 0.13
26 0.17
27 0.19
28 0.22
29 0.22
30 0.18
31 0.17
32 0.17
33 0.18
34 0.17
35 0.16
36 0.18
37 0.23
38 0.32
39 0.43
40 0.53
41 0.62
42 0.7
43 0.79
44 0.86
45 0.89
46 0.89
47 0.86
48 0.82
49 0.74
50 0.68
51 0.59
52 0.48
53 0.39
54 0.29
55 0.22
56 0.15
57 0.13
58 0.11
59 0.09
60 0.12
61 0.12
62 0.13
63 0.16
64 0.17
65 0.19
66 0.22
67 0.25
68 0.26
69 0.28
70 0.29
71 0.25
72 0.26
73 0.25
74 0.21
75 0.2
76 0.16
77 0.13
78 0.13
79 0.14
80 0.13
81 0.15
82 0.18
83 0.16
84 0.18
85 0.19
86 0.18
87 0.17
88 0.18
89 0.16
90 0.13
91 0.12
92 0.1
93 0.09
94 0.09
95 0.08
96 0.07
97 0.05
98 0.05
99 0.06
100 0.06
101 0.11
102 0.15
103 0.16
104 0.2
105 0.25
106 0.3
107 0.38
108 0.47
109 0.52
110 0.59
111 0.66
112 0.73
113 0.71
114 0.68
115 0.63
116 0.54
117 0.46
118 0.37
119 0.29
120 0.19
121 0.17
122 0.15
123 0.11
124 0.1
125 0.08
126 0.07
127 0.1
128 0.11
129 0.11
130 0.15
131 0.18