Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2SAG4

Protein Details
Accession W2SAG4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
45-73NQPHPPQQLKRKAIPRRLRRDWRAPRVDYHydrophilic
NLS Segment(s)
PositionSequence
54-67KRKAIPRRLRRDWR
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MPGPRPAPSVAPLKPLQQIILSHNAIATRNSLSGVKSSYHLFLKNQPHPPQQLKRKAIPRRLRRDWRAPRVDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.3
4 0.25
5 0.26
6 0.23
7 0.29
8 0.26
9 0.22
10 0.22
11 0.22
12 0.19
13 0.18
14 0.16
15 0.1
16 0.1
17 0.11
18 0.11
19 0.1
20 0.11
21 0.12
22 0.11
23 0.11
24 0.12
25 0.13
26 0.14
27 0.15
28 0.15
29 0.21
30 0.3
31 0.36
32 0.43
33 0.46
34 0.49
35 0.55
36 0.62
37 0.64
38 0.65
39 0.69
40 0.66
41 0.69
42 0.75
43 0.78
44 0.79
45 0.8
46 0.81
47 0.81
48 0.86
49 0.88
50 0.87
51 0.89
52 0.9
53 0.9