Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2RYA8

Protein Details
Accession W2RYA8   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
110-135TLPPSQPLPQRRPPPRRRFHPPTLFHHydrophilic
NLS Segment(s)
PositionSequence
121-127RPPPRRR
174-181RSGARKRP
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, mito 4, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MDLTPPPSRPPVSTSSHPSAIEIQSPEICVICLDLLSVASPADQDHSAARLTTSNGDTAKVATALPCQHSQFHYSCLGTWFSHSQTCPLCKTSVQCLTIHHDGSEAETITLPPSQPLPQRRPPPRRRFHPPTLFHPRSSGPAKPPTATELTLAFRRQLYARRIPSLYRGRGITRSGARKRPIRPNITPASFGPSAPDAQRLHRLATIWIRRELLLFPFLHPTSPEPSHPSSFTTTPTLPTGLGVTPRSHNDGGEYTRPPQRRTTAAHLLPFTLAVLQRIDLKGSAGQAVELLGEYLGRENAQLFCHELVGFLGSGARSVEEWDGEVMYWFDGEGEGEVRSGKGEVLGRLDDGDGGDEEGDEEEGEGPAVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.53
4 0.51
5 0.47
6 0.47
7 0.41
8 0.4
9 0.33
10 0.3
11 0.26
12 0.27
13 0.25
14 0.2
15 0.18
16 0.12
17 0.12
18 0.09
19 0.07
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.09
30 0.09
31 0.09
32 0.1
33 0.12
34 0.13
35 0.13
36 0.13
37 0.12
38 0.14
39 0.18
40 0.18
41 0.2
42 0.2
43 0.2
44 0.2
45 0.19
46 0.18
47 0.14
48 0.13
49 0.11
50 0.14
51 0.17
52 0.2
53 0.23
54 0.23
55 0.26
56 0.27
57 0.32
58 0.29
59 0.29
60 0.3
61 0.27
62 0.26
63 0.25
64 0.26
65 0.21
66 0.23
67 0.23
68 0.2
69 0.24
70 0.23
71 0.26
72 0.28
73 0.32
74 0.31
75 0.3
76 0.3
77 0.28
78 0.31
79 0.35
80 0.37
81 0.35
82 0.33
83 0.34
84 0.39
85 0.41
86 0.38
87 0.29
88 0.23
89 0.2
90 0.22
91 0.21
92 0.14
93 0.1
94 0.1
95 0.1
96 0.11
97 0.12
98 0.09
99 0.08
100 0.1
101 0.13
102 0.19
103 0.27
104 0.34
105 0.41
106 0.51
107 0.61
108 0.71
109 0.77
110 0.82
111 0.84
112 0.85
113 0.87
114 0.86
115 0.86
116 0.86
117 0.8
118 0.78
119 0.79
120 0.73
121 0.63
122 0.57
123 0.48
124 0.43
125 0.41
126 0.36
127 0.31
128 0.35
129 0.37
130 0.34
131 0.34
132 0.32
133 0.31
134 0.27
135 0.23
136 0.18
137 0.18
138 0.2
139 0.2
140 0.17
141 0.15
142 0.15
143 0.16
144 0.21
145 0.25
146 0.31
147 0.34
148 0.36
149 0.37
150 0.37
151 0.44
152 0.45
153 0.41
154 0.35
155 0.33
156 0.31
157 0.33
158 0.34
159 0.3
160 0.27
161 0.34
162 0.38
163 0.42
164 0.46
165 0.5
166 0.55
167 0.61
168 0.63
169 0.62
170 0.59
171 0.6
172 0.61
173 0.56
174 0.51
175 0.41
176 0.39
177 0.31
178 0.28
179 0.22
180 0.16
181 0.16
182 0.14
183 0.19
184 0.14
185 0.16
186 0.23
187 0.22
188 0.23
189 0.23
190 0.23
191 0.21
192 0.28
193 0.32
194 0.27
195 0.28
196 0.28
197 0.27
198 0.27
199 0.25
200 0.19
201 0.17
202 0.15
203 0.14
204 0.18
205 0.18
206 0.17
207 0.17
208 0.17
209 0.18
210 0.19
211 0.2
212 0.21
213 0.24
214 0.26
215 0.26
216 0.26
217 0.25
218 0.24
219 0.25
220 0.24
221 0.21
222 0.21
223 0.21
224 0.2
225 0.16
226 0.15
227 0.14
228 0.11
229 0.14
230 0.13
231 0.14
232 0.15
233 0.17
234 0.22
235 0.21
236 0.2
237 0.19
238 0.21
239 0.23
240 0.26
241 0.26
242 0.25
243 0.32
244 0.35
245 0.35
246 0.37
247 0.38
248 0.39
249 0.43
250 0.48
251 0.51
252 0.51
253 0.53
254 0.47
255 0.44
256 0.38
257 0.32
258 0.23
259 0.16
260 0.12
261 0.1
262 0.1
263 0.09
264 0.13
265 0.13
266 0.14
267 0.12
268 0.13
269 0.13
270 0.13
271 0.14
272 0.11
273 0.1
274 0.09
275 0.09
276 0.08
277 0.06
278 0.06
279 0.04
280 0.04
281 0.04
282 0.05
283 0.06
284 0.06
285 0.06
286 0.07
287 0.1
288 0.11
289 0.12
290 0.13
291 0.13
292 0.15
293 0.14
294 0.13
295 0.12
296 0.12
297 0.11
298 0.08
299 0.09
300 0.07
301 0.08
302 0.08
303 0.08
304 0.06
305 0.09
306 0.1
307 0.09
308 0.1
309 0.1
310 0.1
311 0.1
312 0.1
313 0.09
314 0.08
315 0.07
316 0.06
317 0.06
318 0.05
319 0.06
320 0.06
321 0.07
322 0.07
323 0.07
324 0.08
325 0.08
326 0.08
327 0.09
328 0.08
329 0.11
330 0.14
331 0.16
332 0.19
333 0.2
334 0.2
335 0.2
336 0.2
337 0.17
338 0.14
339 0.14
340 0.1
341 0.1
342 0.09
343 0.08
344 0.09
345 0.09
346 0.09
347 0.07
348 0.07
349 0.07
350 0.07
351 0.07