Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2SEK2

Protein Details
Accession W2SEK2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
149-180AKARGKPLPSPPKPQKPKKPKKGQPVPVVPETHydrophilic
NLS Segment(s)
PositionSequence
143-171RKKLERAKARGKPLPSPPKPQKPKKPKKG
Subcellular Location(s) extr 20, golg 3, nucl 1, mito 1, plas 1, E.R. 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MRPASFMLRGVLLLLACIFQALAADPKYSSTITLSYEFISSPSKPSPLATISYDPSTLRYSLSSWTPPSIADLKSSSQDPTSAPLIRILTPGGSSTVTTLSTFASDLKQNINLFLSSTDNAVLSASVTSIRPAPLTEEEAHYRKKLERAKARGKPLPSPPKPQKPKKPKKGQPVPVVPETPIDDTPEGQPKVNLIPELEGPRPKLMSRAAPVVDEHGNEVPQAEQQEKTFLQKYWWVLVAGLVLTMGMGGGEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.05
6 0.04
7 0.05
8 0.06
9 0.1
10 0.11
11 0.12
12 0.12
13 0.14
14 0.16
15 0.16
16 0.15
17 0.13
18 0.14
19 0.17
20 0.19
21 0.18
22 0.17
23 0.18
24 0.17
25 0.16
26 0.18
27 0.15
28 0.17
29 0.19
30 0.19
31 0.19
32 0.2
33 0.23
34 0.22
35 0.24
36 0.24
37 0.25
38 0.26
39 0.26
40 0.27
41 0.22
42 0.23
43 0.22
44 0.18
45 0.16
46 0.14
47 0.14
48 0.16
49 0.19
50 0.2
51 0.19
52 0.2
53 0.2
54 0.19
55 0.22
56 0.23
57 0.2
58 0.19
59 0.19
60 0.19
61 0.2
62 0.21
63 0.18
64 0.15
65 0.16
66 0.14
67 0.15
68 0.18
69 0.17
70 0.17
71 0.19
72 0.2
73 0.19
74 0.19
75 0.16
76 0.13
77 0.11
78 0.11
79 0.09
80 0.08
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.07
90 0.07
91 0.08
92 0.09
93 0.1
94 0.11
95 0.14
96 0.14
97 0.14
98 0.15
99 0.13
100 0.12
101 0.12
102 0.12
103 0.09
104 0.09
105 0.08
106 0.08
107 0.08
108 0.07
109 0.06
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.06
117 0.06
118 0.06
119 0.06
120 0.09
121 0.1
122 0.13
123 0.13
124 0.15
125 0.19
126 0.21
127 0.23
128 0.21
129 0.21
130 0.2
131 0.27
132 0.31
133 0.37
134 0.43
135 0.51
136 0.61
137 0.66
138 0.72
139 0.69
140 0.65
141 0.62
142 0.63
143 0.65
144 0.59
145 0.62
146 0.63
147 0.7
148 0.77
149 0.81
150 0.82
151 0.82
152 0.89
153 0.9
154 0.92
155 0.9
156 0.92
157 0.92
158 0.91
159 0.89
160 0.87
161 0.81
162 0.74
163 0.66
164 0.55
165 0.47
166 0.39
167 0.32
168 0.23
169 0.21
170 0.17
171 0.17
172 0.2
173 0.26
174 0.25
175 0.22
176 0.22
177 0.21
178 0.23
179 0.24
180 0.22
181 0.14
182 0.15
183 0.18
184 0.23
185 0.25
186 0.24
187 0.24
188 0.26
189 0.27
190 0.25
191 0.26
192 0.25
193 0.29
194 0.3
195 0.34
196 0.32
197 0.32
198 0.32
199 0.32
200 0.29
201 0.23
202 0.22
203 0.18
204 0.17
205 0.16
206 0.16
207 0.12
208 0.13
209 0.15
210 0.14
211 0.14
212 0.15
213 0.21
214 0.21
215 0.27
216 0.28
217 0.26
218 0.28
219 0.32
220 0.35
221 0.34
222 0.35
223 0.3
224 0.26
225 0.26
226 0.24
227 0.18
228 0.14
229 0.09
230 0.07
231 0.06
232 0.05
233 0.04
234 0.02