Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2SC63

Protein Details
Accession W2SC63    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 17, mito 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKATSDKLNKDVQSYRLVTVAVLVDRLKINGSLARAALKDLEEKGVIRKVVGHSRGSIYTRAAAGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.49
15 0.39
16 0.34
17 0.27
18 0.17
19 0.15
20 0.13
21 0.14
22 0.12
23 0.13
24 0.15
25 0.2
26 0.2
27 0.23
28 0.25
29 0.26
30 0.3
31 0.3
32 0.27
33 0.22
34 0.22
35 0.17
36 0.15
37 0.13
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.1
49 0.1
50 0.1
51 0.12
52 0.12
53 0.12
54 0.12
55 0.11
56 0.12
57 0.12
58 0.13
59 0.12
60 0.13
61 0.16
62 0.2
63 0.19
64 0.17
65 0.2
66 0.23
67 0.31
68 0.35
69 0.33
70 0.31
71 0.35
72 0.39
73 0.38
74 0.35
75 0.28
76 0.27
77 0.25