Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F5A9

Protein Details
Accession A7F5A9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-70KATLRRGKCRSKPADKILGFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 9.5, cyto 4.5
Family & Domain DBs
KEGG ssl:SS1G_12785  -  
Amino Acid Sequences MIGRESLRVEHLNSLGYICKRCSEENVAHHTNCSGCELVTKRVLQEFIVEKATLRRGKCRSKPADKILGFLRPERASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.21
4 0.22
5 0.19
6 0.21
7 0.23
8 0.24
9 0.27
10 0.29
11 0.33
12 0.37
13 0.44
14 0.44
15 0.41
16 0.4
17 0.36
18 0.3
19 0.24
20 0.2
21 0.12
22 0.08
23 0.12
24 0.14
25 0.16
26 0.19
27 0.18
28 0.17
29 0.18
30 0.19
31 0.15
32 0.17
33 0.16
34 0.15
35 0.17
36 0.16
37 0.15
38 0.17
39 0.25
40 0.25
41 0.24
42 0.31
43 0.37
44 0.48
45 0.56
46 0.63
47 0.66
48 0.72
49 0.8
50 0.79
51 0.82
52 0.72
53 0.68
54 0.61
55 0.58
56 0.5
57 0.44
58 0.43