Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EG34

Protein Details
Accession A7EG34    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
195-217VTYTPRMSPAPKGKRRKVDHNVEHydrophilic
NLS Segment(s)
PositionSequence
206-210KGKRR
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
KEGG ssl:SS1G_04275  -  
Amino Acid Sequences MSSSKPKLPQLKTPMSSTFPSELSALSNSARSPLPGYADFMIKQEDTIKTPITPPLAYTDFLKTMNSPIVAEIKCSRPTPTSAPSSDSLTSSESSDCSCNCDAHKSPASSVPPTPFLYPTSAPSSAILGRLRIPASPASSYADSPLSARSPFSARSARSPYDWDMRGKGRYFDIKPQKQTRSSVRQVREVVTRTVTYTPRMSPAPKGKRRKVDHNVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.54
4 0.49
5 0.42
6 0.32
7 0.3
8 0.26
9 0.21
10 0.19
11 0.19
12 0.16
13 0.14
14 0.14
15 0.13
16 0.15
17 0.15
18 0.13
19 0.15
20 0.15
21 0.19
22 0.18
23 0.22
24 0.21
25 0.23
26 0.22
27 0.21
28 0.22
29 0.17
30 0.16
31 0.17
32 0.18
33 0.18
34 0.2
35 0.2
36 0.19
37 0.2
38 0.23
39 0.22
40 0.2
41 0.18
42 0.22
43 0.22
44 0.22
45 0.22
46 0.22
47 0.2
48 0.21
49 0.21
50 0.15
51 0.15
52 0.17
53 0.16
54 0.12
55 0.12
56 0.18
57 0.17
58 0.19
59 0.2
60 0.21
61 0.24
62 0.25
63 0.26
64 0.21
65 0.25
66 0.28
67 0.3
68 0.31
69 0.29
70 0.31
71 0.3
72 0.32
73 0.29
74 0.25
75 0.2
76 0.17
77 0.16
78 0.14
79 0.13
80 0.1
81 0.1
82 0.11
83 0.1
84 0.12
85 0.13
86 0.13
87 0.13
88 0.18
89 0.19
90 0.24
91 0.28
92 0.25
93 0.25
94 0.29
95 0.31
96 0.27
97 0.27
98 0.23
99 0.21
100 0.22
101 0.22
102 0.18
103 0.17
104 0.18
105 0.17
106 0.18
107 0.2
108 0.19
109 0.18
110 0.17
111 0.18
112 0.15
113 0.18
114 0.15
115 0.12
116 0.13
117 0.15
118 0.15
119 0.13
120 0.14
121 0.13
122 0.15
123 0.15
124 0.15
125 0.16
126 0.17
127 0.17
128 0.17
129 0.15
130 0.13
131 0.13
132 0.13
133 0.12
134 0.11
135 0.11
136 0.12
137 0.13
138 0.15
139 0.19
140 0.23
141 0.23
142 0.3
143 0.36
144 0.36
145 0.35
146 0.37
147 0.37
148 0.38
149 0.39
150 0.35
151 0.34
152 0.37
153 0.4
154 0.38
155 0.36
156 0.33
157 0.38
158 0.39
159 0.44
160 0.51
161 0.54
162 0.62
163 0.68
164 0.71
165 0.68
166 0.72
167 0.72
168 0.7
169 0.72
170 0.72
171 0.67
172 0.68
173 0.66
174 0.62
175 0.6
176 0.53
177 0.47
178 0.42
179 0.38
180 0.33
181 0.35
182 0.33
183 0.3
184 0.31
185 0.29
186 0.3
187 0.33
188 0.33
189 0.37
190 0.46
191 0.53
192 0.59
193 0.68
194 0.74
195 0.8
196 0.86
197 0.87