Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2S098

Protein Details
Accession W2S098   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
194-215NELKLKLRRKARRLKLERQAGRBasic
316-336LWNARNTKRIRREEKADARLDHydrophilic
NLS Segment(s)
PositionSequence
197-210KLKLRRKARRLKLE
Subcellular Location(s) nucl 14, cyto 7.5, cyto_mito 7, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040152  Atp25  
IPR043519  NT_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0140053  P:mitochondrial gene expression  
Pfam View protein in Pfam  
PF02410  RsfS  
Amino Acid Sequences MSPTTLHCQACRYSFLDAFTSIAGISLPAQRISRLPLRSFQTSQRQRQLHTTARRLLPIQAEKHASSPLDTEPTAPESRTPSEIPWYLQVSNPTPPAPVSPILARQEIPPLPSNPPAVLLPVLTHLSTSIGLDNLTLLDLRTLSPPPALGANLLMIIGTARSVKHLNVSADRFCRWLRTTYKLRPYADGLLGRNELKLKLRRKARRLKLERQAGRTGVEEGADDGITTGWVCVNVGPVDDVVLEEAETTAADVAEPAEEMDAADEEEYTNPSSELPENDTDDDPTYVGFGSRETSQRIVVQLFTEEKRAEMNLEELWNARNTKRIRREEKADARLDYARRQKELVEDGEQEEPDNKSGTRRDEEWAPLFKGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.33
4 0.28
5 0.26
6 0.22
7 0.2
8 0.14
9 0.12
10 0.09
11 0.07
12 0.08
13 0.12
14 0.13
15 0.15
16 0.16
17 0.18
18 0.19
19 0.25
20 0.31
21 0.33
22 0.34
23 0.38
24 0.43
25 0.49
26 0.51
27 0.53
28 0.56
29 0.6
30 0.67
31 0.69
32 0.67
33 0.63
34 0.69
35 0.69
36 0.67
37 0.67
38 0.66
39 0.64
40 0.63
41 0.63
42 0.56
43 0.52
44 0.51
45 0.49
46 0.44
47 0.41
48 0.43
49 0.41
50 0.41
51 0.4
52 0.31
53 0.25
54 0.24
55 0.21
56 0.2
57 0.19
58 0.19
59 0.18
60 0.23
61 0.23
62 0.21
63 0.21
64 0.22
65 0.24
66 0.27
67 0.26
68 0.23
69 0.28
70 0.3
71 0.29
72 0.29
73 0.3
74 0.27
75 0.27
76 0.3
77 0.26
78 0.28
79 0.28
80 0.24
81 0.21
82 0.21
83 0.21
84 0.2
85 0.18
86 0.17
87 0.17
88 0.22
89 0.24
90 0.25
91 0.24
92 0.21
93 0.26
94 0.25
95 0.26
96 0.24
97 0.24
98 0.26
99 0.28
100 0.29
101 0.22
102 0.23
103 0.2
104 0.18
105 0.16
106 0.12
107 0.1
108 0.1
109 0.11
110 0.09
111 0.09
112 0.08
113 0.08
114 0.08
115 0.08
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.05
128 0.07
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.09
135 0.09
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.05
142 0.04
143 0.04
144 0.03
145 0.03
146 0.04
147 0.04
148 0.06
149 0.07
150 0.07
151 0.1
152 0.14
153 0.16
154 0.2
155 0.23
156 0.24
157 0.25
158 0.26
159 0.25
160 0.22
161 0.24
162 0.21
163 0.25
164 0.25
165 0.31
166 0.39
167 0.44
168 0.53
169 0.55
170 0.54
171 0.5
172 0.49
173 0.44
174 0.39
175 0.34
176 0.26
177 0.22
178 0.22
179 0.2
180 0.18
181 0.16
182 0.14
183 0.17
184 0.24
185 0.27
186 0.33
187 0.43
188 0.5
189 0.59
190 0.69
191 0.73
192 0.76
193 0.79
194 0.82
195 0.82
196 0.83
197 0.79
198 0.74
199 0.68
200 0.57
201 0.5
202 0.41
203 0.33
204 0.23
205 0.18
206 0.13
207 0.1
208 0.09
209 0.08
210 0.07
211 0.05
212 0.05
213 0.04
214 0.04
215 0.04
216 0.03
217 0.03
218 0.04
219 0.04
220 0.06
221 0.06
222 0.06
223 0.07
224 0.06
225 0.07
226 0.06
227 0.06
228 0.05
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.03
235 0.04
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.04
243 0.04
244 0.03
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.05
253 0.05
254 0.07
255 0.07
256 0.08
257 0.08
258 0.08
259 0.1
260 0.11
261 0.13
262 0.16
263 0.17
264 0.19
265 0.22
266 0.22
267 0.22
268 0.21
269 0.2
270 0.16
271 0.13
272 0.11
273 0.09
274 0.09
275 0.07
276 0.06
277 0.08
278 0.11
279 0.14
280 0.16
281 0.18
282 0.19
283 0.21
284 0.24
285 0.23
286 0.21
287 0.19
288 0.19
289 0.22
290 0.21
291 0.23
292 0.2
293 0.19
294 0.2
295 0.2
296 0.18
297 0.15
298 0.16
299 0.15
300 0.16
301 0.16
302 0.15
303 0.16
304 0.19
305 0.2
306 0.19
307 0.24
308 0.28
309 0.38
310 0.48
311 0.57
312 0.62
313 0.68
314 0.75
315 0.78
316 0.84
317 0.82
318 0.77
319 0.68
320 0.63
321 0.61
322 0.56
323 0.54
324 0.53
325 0.5
326 0.47
327 0.46
328 0.44
329 0.45
330 0.48
331 0.44
332 0.4
333 0.37
334 0.37
335 0.4
336 0.38
337 0.31
338 0.28
339 0.25
340 0.21
341 0.21
342 0.19
343 0.22
344 0.28
345 0.34
346 0.37
347 0.37
348 0.4
349 0.44
350 0.51
351 0.52
352 0.52