Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2RID6

Protein Details
Accession W2RID6    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-79MSRSRSEKQGKTRKKPRGLFLHydrophilic
NLS Segment(s)
PositionSequence
65-75EKQGKTRKKPR
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MLYQYLMDEVARKRIKVVKKGDENIALDRIDDGDGNTRTTRLGAGEPVKSKDTGLLTVMSRSRSEKQGKTRKKPRGLFLGVGHRGGNGETSDDSTPPTPRLPALAESTVEGEVVKRDNRLTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.49
4 0.57
5 0.57
6 0.64
7 0.68
8 0.69
9 0.67
10 0.61
11 0.55
12 0.48
13 0.38
14 0.28
15 0.24
16 0.2
17 0.14
18 0.12
19 0.09
20 0.13
21 0.14
22 0.16
23 0.16
24 0.16
25 0.15
26 0.16
27 0.15
28 0.1
29 0.1
30 0.12
31 0.15
32 0.19
33 0.21
34 0.23
35 0.24
36 0.22
37 0.21
38 0.2
39 0.18
40 0.15
41 0.13
42 0.13
43 0.12
44 0.14
45 0.16
46 0.14
47 0.13
48 0.15
49 0.17
50 0.22
51 0.28
52 0.32
53 0.41
54 0.51
55 0.6
56 0.68
57 0.75
58 0.78
59 0.82
60 0.81
61 0.77
62 0.76
63 0.7
64 0.63
65 0.58
66 0.58
67 0.49
68 0.44
69 0.38
70 0.29
71 0.25
72 0.21
73 0.18
74 0.08
75 0.09
76 0.08
77 0.11
78 0.12
79 0.12
80 0.14
81 0.14
82 0.16
83 0.16
84 0.17
85 0.15
86 0.15
87 0.18
88 0.19
89 0.2
90 0.24
91 0.24
92 0.23
93 0.23
94 0.24
95 0.21
96 0.18
97 0.15
98 0.1
99 0.11
100 0.15
101 0.15
102 0.16