Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F5X5

Protein Details
Accession A7F5X5    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
249-284RVWHPSTNPTRPNKPKCPPCERKKKRFDCLGAPPCNHydrophilic
294-317EQCASFTFLRRRGKRRLQDDDGMVHydrophilic
NLS Segment(s)
PositionSequence
320-328KAGKREKRR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
KEGG ssl:SS1G_13003  -  
Amino Acid Sequences MEDENEASNVQPPSSEHEGFIEERFDEKFPIIEVCEISAPNTSGSVTPEVVTPEEDSSDVEMCSDENSPSNEAHDIEVTQHNPGDDTAENAAQGKELPNAPDLDLQLSTTDISELEISEAEPSEPEFPETKPLQIEVTQLSEHLPEIIEIEVPQLLSPSPEPIDVDIPEQSDSSPELSEIPNQGLQDHSGSDADNECSDGKTTRVLGDWQLRQLAENALEIALDVSAPKPSAQLSEPNICKPRTPLPERVWHPSTNPTRPNKPKCPPCERKKKRFDCLGAPPCNECSKRNMTAEQCASFTFLRRRGKRRLQDDDGMVTQKAGKREKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.24
4 0.26
5 0.29
6 0.29
7 0.3
8 0.24
9 0.17
10 0.18
11 0.19
12 0.18
13 0.17
14 0.16
15 0.15
16 0.14
17 0.16
18 0.16
19 0.16
20 0.16
21 0.16
22 0.17
23 0.16
24 0.16
25 0.16
26 0.15
27 0.14
28 0.14
29 0.13
30 0.12
31 0.15
32 0.16
33 0.14
34 0.14
35 0.15
36 0.16
37 0.16
38 0.16
39 0.15
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.13
46 0.12
47 0.1
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.1
54 0.13
55 0.14
56 0.15
57 0.16
58 0.16
59 0.16
60 0.16
61 0.15
62 0.13
63 0.14
64 0.18
65 0.17
66 0.17
67 0.16
68 0.15
69 0.15
70 0.15
71 0.15
72 0.11
73 0.12
74 0.13
75 0.13
76 0.13
77 0.13
78 0.13
79 0.1
80 0.11
81 0.09
82 0.1
83 0.11
84 0.12
85 0.13
86 0.14
87 0.15
88 0.17
89 0.16
90 0.15
91 0.14
92 0.13
93 0.11
94 0.11
95 0.1
96 0.07
97 0.07
98 0.05
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.05
108 0.05
109 0.06
110 0.07
111 0.08
112 0.09
113 0.1
114 0.1
115 0.17
116 0.17
117 0.18
118 0.16
119 0.17
120 0.17
121 0.16
122 0.18
123 0.12
124 0.14
125 0.12
126 0.12
127 0.12
128 0.1
129 0.09
130 0.08
131 0.07
132 0.05
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.07
149 0.08
150 0.09
151 0.09
152 0.1
153 0.09
154 0.09
155 0.1
156 0.09
157 0.08
158 0.07
159 0.08
160 0.08
161 0.07
162 0.06
163 0.07
164 0.08
165 0.09
166 0.1
167 0.1
168 0.11
169 0.11
170 0.11
171 0.1
172 0.1
173 0.09
174 0.09
175 0.08
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.08
182 0.09
183 0.08
184 0.08
185 0.09
186 0.09
187 0.09
188 0.1
189 0.11
190 0.1
191 0.11
192 0.12
193 0.16
194 0.23
195 0.24
196 0.23
197 0.24
198 0.23
199 0.23
200 0.23
201 0.2
202 0.13
203 0.12
204 0.11
205 0.09
206 0.08
207 0.08
208 0.07
209 0.05
210 0.04
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.06
217 0.07
218 0.09
219 0.11
220 0.17
221 0.21
222 0.29
223 0.31
224 0.36
225 0.41
226 0.39
227 0.39
228 0.37
229 0.41
230 0.42
231 0.46
232 0.49
233 0.5
234 0.6
235 0.62
236 0.67
237 0.61
238 0.53
239 0.5
240 0.5
241 0.53
242 0.52
243 0.56
244 0.55
245 0.62
246 0.71
247 0.78
248 0.79
249 0.81
250 0.82
251 0.83
252 0.87
253 0.87
254 0.88
255 0.89
256 0.9
257 0.91
258 0.92
259 0.93
260 0.91
261 0.9
262 0.86
263 0.83
264 0.84
265 0.83
266 0.78
267 0.71
268 0.63
269 0.57
270 0.58
271 0.51
272 0.42
273 0.4
274 0.4
275 0.45
276 0.47
277 0.51
278 0.48
279 0.55
280 0.59
281 0.53
282 0.46
283 0.4
284 0.39
285 0.32
286 0.34
287 0.33
288 0.36
289 0.44
290 0.52
291 0.6
292 0.67
293 0.77
294 0.81
295 0.83
296 0.84
297 0.81
298 0.8
299 0.77
300 0.72
301 0.65
302 0.58
303 0.48
304 0.38
305 0.35
306 0.31
307 0.34
308 0.37