Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EQ90

Protein Details
Accession A7EQ90   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-55VEYGRFRGRKRERVHYRLPSBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, cysk 11, cyto 3
Family & Domain DBs
KEGG ssl:SS1G_07490  -  
Amino Acid Sequences MLSSNNNDDNNVVHIIVMDHKSIERIFRWESKRPVVEYGRFRGRKRERVHYRLPSLLPLRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.14
4 0.14
5 0.11
6 0.1
7 0.1
8 0.12
9 0.12
10 0.14
11 0.12
12 0.14
13 0.17
14 0.24
15 0.29
16 0.35
17 0.38
18 0.42
19 0.43
20 0.41
21 0.44
22 0.42
23 0.43
24 0.42
25 0.44
26 0.48
27 0.5
28 0.5
29 0.55
30 0.59
31 0.61
32 0.63
33 0.68
34 0.68
35 0.71
36 0.81
37 0.79
38 0.76
39 0.74
40 0.69
41 0.66