Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2SGE4

Protein Details
Accession W2SGE4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
11-38LIHDKIKGDRAKRREKKRKGYEVRYSELBasic
NLS Segment(s)
PositionSequence
16-30IKGDRAKRREKKRKG
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MASLLVGASLLIHDKIKGDRAKRREKKRKGYEVRYSELEKEHKSHEADVLHRKSTGGSMGNQDTSAPGPAPRSRNSQDSLRSNQDGPARWVEEALKENQSKHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.2
4 0.26
5 0.32
6 0.4
7 0.49
8 0.6
9 0.68
10 0.77
11 0.81
12 0.85
13 0.89
14 0.91
15 0.93
16 0.92
17 0.92
18 0.91
19 0.86
20 0.79
21 0.72
22 0.63
23 0.54
24 0.48
25 0.42
26 0.34
27 0.3
28 0.28
29 0.28
30 0.27
31 0.25
32 0.25
33 0.23
34 0.25
35 0.31
36 0.32
37 0.28
38 0.27
39 0.26
40 0.22
41 0.21
42 0.19
43 0.12
44 0.11
45 0.14
46 0.15
47 0.16
48 0.15
49 0.14
50 0.12
51 0.11
52 0.11
53 0.08
54 0.07
55 0.11
56 0.16
57 0.2
58 0.22
59 0.29
60 0.32
61 0.36
62 0.39
63 0.41
64 0.45
65 0.48
66 0.51
67 0.5
68 0.5
69 0.46
70 0.47
71 0.45
72 0.4
73 0.38
74 0.38
75 0.33
76 0.31
77 0.31
78 0.28
79 0.28
80 0.29
81 0.28
82 0.3
83 0.3