Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E7G4

Protein Details
Accession A7E7G4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-70ICNLQRKFVKLKEKKGKKVGSHydrophilic
NLS Segment(s)
PositionSequence
58-69VKLKEKKGKKVG
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
KEGG ssl:SS1G_01242  -  
Amino Acid Sequences MSRRSMTVIIIEIGSVPWRMNKIVRGKSRYSEVETTSLLKIIKLGTANVICNLQRKFVKLKEKKGKKVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.07
4 0.08
5 0.1
6 0.12
7 0.14
8 0.2
9 0.28
10 0.37
11 0.44
12 0.48
13 0.49
14 0.5
15 0.53
16 0.49
17 0.45
18 0.39
19 0.33
20 0.3
21 0.27
22 0.27
23 0.21
24 0.2
25 0.15
26 0.12
27 0.11
28 0.09
29 0.11
30 0.09
31 0.09
32 0.12
33 0.13
34 0.14
35 0.14
36 0.16
37 0.15
38 0.2
39 0.21
40 0.23
41 0.23
42 0.26
43 0.33
44 0.38
45 0.49
46 0.52
47 0.62
48 0.68
49 0.77
50 0.83