Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2RW13

Protein Details
Accession W2RW13    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-60VLLCCCIAHRRKKARKPPIWGTAWHydrophilic
NLS Segment(s)
PositionSequence
46-53RRKKARKP
Subcellular Location(s) mito 11, plas 6, cyto 5, extr 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPMCTSRNARKYECSNLWHDVGIWLVTAGLVTLAISVLLCCCIAHRRKKARKPPIWGTAWATKVSTKQPQVERAKPTTAEPRVGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.53
4 0.5
5 0.42
6 0.36
7 0.27
8 0.21
9 0.17
10 0.11
11 0.07
12 0.06
13 0.05
14 0.05
15 0.04
16 0.03
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.03
28 0.04
29 0.1
30 0.17
31 0.25
32 0.35
33 0.46
34 0.56
35 0.66
36 0.76
37 0.81
38 0.83
39 0.83
40 0.82
41 0.8
42 0.73
43 0.66
44 0.61
45 0.56
46 0.5
47 0.42
48 0.34
49 0.27
50 0.27
51 0.3
52 0.33
53 0.31
54 0.37
55 0.42
56 0.51
57 0.58
58 0.62
59 0.64
60 0.6
61 0.6
62 0.54
63 0.54
64 0.54
65 0.5
66 0.48