Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2RU06

Protein Details
Accession W2RU06    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-75SNQKKEFKGFDRRKKEEKERVHVFBasic
NLS Segment(s)
PositionSequence
55-71KKEFKGFDRRKKEEKER
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MSNDPLEVSPANRSVSETTSEVDGQAEPSGRKSPTQAEPSFYSESLGKTKSSNQKKEFKGFDRRKKEEKERVHVFGPGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.24
4 0.21
5 0.19
6 0.19
7 0.19
8 0.16
9 0.15
10 0.13
11 0.1
12 0.1
13 0.11
14 0.09
15 0.12
16 0.15
17 0.15
18 0.15
19 0.16
20 0.21
21 0.26
22 0.33
23 0.32
24 0.32
25 0.34
26 0.38
27 0.37
28 0.32
29 0.26
30 0.19
31 0.2
32 0.19
33 0.17
34 0.13
35 0.13
36 0.21
37 0.29
38 0.38
39 0.46
40 0.51
41 0.59
42 0.64
43 0.71
44 0.71
45 0.68
46 0.7
47 0.71
48 0.75
49 0.76
50 0.78
51 0.79
52 0.81
53 0.85
54 0.84
55 0.83
56 0.83
57 0.8
58 0.77
59 0.7
60 0.64