Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E5V0

Protein Details
Accession A7E5V0    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-83SSYTNKKSCGKKKYDDEALSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, cyto 10, nucl 7, mito 5, cysk 5
Family & Domain DBs
KEGG ssl:SS1G_00675  -  
Amino Acid Sequences MIVVAGIGSLSKEEGVVQKGIEEEGGAYYANIKFNRTTDPDIIIIPRYIRRSQFYIGVISSHGSSYTNKKSCGKKKYDDEALSSRNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.12
5 0.13
6 0.13
7 0.13
8 0.12
9 0.08
10 0.06
11 0.06
12 0.06
13 0.05
14 0.05
15 0.07
16 0.08
17 0.13
18 0.13
19 0.14
20 0.14
21 0.15
22 0.2
23 0.22
24 0.24
25 0.21
26 0.23
27 0.22
28 0.22
29 0.21
30 0.18
31 0.14
32 0.11
33 0.13
34 0.15
35 0.17
36 0.19
37 0.21
38 0.24
39 0.25
40 0.29
41 0.27
42 0.25
43 0.23
44 0.21
45 0.18
46 0.15
47 0.14
48 0.1
49 0.09
50 0.08
51 0.1
52 0.17
53 0.26
54 0.3
55 0.34
56 0.41
57 0.51
58 0.59
59 0.67
60 0.68
61 0.68
62 0.74
63 0.79
64 0.82
65 0.75
66 0.73
67 0.7