Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2S533

Protein Details
Accession W2S533    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
150-175HVEGRARKYVKRKRDVRRWDSEQPGPBasic
NLS Segment(s)
PositionSequence
156-163RKYVKRKR
Subcellular Location(s) mito 21, cyto 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MSTRNKPRLYLALYPRGACTPHFTSSSNCSSYHFSLLVGPGSSLRSDPGKRYHVAHTDDIHHPFLYEETDIQASDEYVPLVRVTLAKVRNSERVTALLRTVEVPSTTSSALECTCLAWTAAAFRLLVADKGSGNRSACLSSYLKPADWDHVEGRARKYVKRKRDVRRWDSEQPGPWDRKAVSTWNYWENRETTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.45
4 0.4
5 0.32
6 0.31
7 0.26
8 0.27
9 0.29
10 0.29
11 0.31
12 0.36
13 0.41
14 0.36
15 0.32
16 0.31
17 0.34
18 0.34
19 0.34
20 0.27
21 0.22
22 0.22
23 0.23
24 0.21
25 0.16
26 0.14
27 0.11
28 0.12
29 0.12
30 0.1
31 0.11
32 0.15
33 0.17
34 0.21
35 0.27
36 0.31
37 0.32
38 0.35
39 0.4
40 0.41
41 0.44
42 0.43
43 0.39
44 0.39
45 0.42
46 0.41
47 0.36
48 0.29
49 0.24
50 0.2
51 0.18
52 0.15
53 0.11
54 0.09
55 0.08
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.12
72 0.15
73 0.17
74 0.2
75 0.22
76 0.29
77 0.3
78 0.3
79 0.25
80 0.25
81 0.25
82 0.23
83 0.2
84 0.14
85 0.13
86 0.12
87 0.11
88 0.09
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.07
100 0.06
101 0.06
102 0.07
103 0.07
104 0.06
105 0.05
106 0.06
107 0.07
108 0.07
109 0.07
110 0.06
111 0.08
112 0.08
113 0.09
114 0.08
115 0.08
116 0.08
117 0.1
118 0.12
119 0.14
120 0.14
121 0.15
122 0.15
123 0.15
124 0.15
125 0.18
126 0.18
127 0.17
128 0.23
129 0.23
130 0.22
131 0.24
132 0.25
133 0.26
134 0.26
135 0.28
136 0.23
137 0.28
138 0.32
139 0.33
140 0.35
141 0.37
142 0.37
143 0.39
144 0.49
145 0.52
146 0.58
147 0.65
148 0.72
149 0.75
150 0.84
151 0.89
152 0.87
153 0.88
154 0.86
155 0.84
156 0.82
157 0.78
158 0.74
159 0.7
160 0.69
161 0.63
162 0.56
163 0.52
164 0.46
165 0.43
166 0.39
167 0.39
168 0.35
169 0.38
170 0.42
171 0.45
172 0.48
173 0.46
174 0.47