Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2SGQ3

Protein Details
Accession W2SGQ3   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-69RESPARVDRLRSRSPRRDRRDDKPRRKDKGFKWKDKRRDEGEPRDRDBasic
73-100QRGYRDHYRPRSRSRSPRRDRSPRHEDDBasic
114-139GDGKSEPKEKRKEKEKKEKKPAAAVPBasic
NLS Segment(s)
PositionSequence
22-135ERESPARVDRLRSRSPRRDRRDDKPRRKDKGFKWKDKRRDEGEPRDRDSGLQRGYRDHYRPRSRSRSPRRDRSPRHEDDSVDRKRPKQNIDDGDGKSEPKEKRKEKEKKEKKPA
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MADNQREDDQHSSSTALADRKERESPARVDRLRSRSPRRDRRDDKPRRKDKGFKWKDKRRDEGEPRDRDSGLQRGYRDHYRPRSRSRSPRRDRSPRHEDDSVDRKRPKQNIDDGDGKSEPKEKRKEKEKKEKKPAAAVPQQPMILVTVNDRLGTKKAIPCFASDTVRDFKIIVASMIGRQPHEILLKRQGERPFKDQLTLQDYGVSNNVQLDLEVDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.21
4 0.21
5 0.26
6 0.28
7 0.32
8 0.36
9 0.37
10 0.39
11 0.42
12 0.46
13 0.49
14 0.56
15 0.53
16 0.57
17 0.62
18 0.63
19 0.67
20 0.7
21 0.71
22 0.72
23 0.81
24 0.84
25 0.85
26 0.88
27 0.86
28 0.87
29 0.88
30 0.89
31 0.89
32 0.89
33 0.91
34 0.88
35 0.9
36 0.89
37 0.88
38 0.88
39 0.87
40 0.87
41 0.88
42 0.89
43 0.91
44 0.9
45 0.88
46 0.83
47 0.83
48 0.82
49 0.82
50 0.81
51 0.78
52 0.73
53 0.67
54 0.6
55 0.51
56 0.45
57 0.41
58 0.36
59 0.33
60 0.29
61 0.3
62 0.34
63 0.39
64 0.4
65 0.42
66 0.48
67 0.54
68 0.6
69 0.66
70 0.71
71 0.73
72 0.79
73 0.82
74 0.83
75 0.82
76 0.86
77 0.87
78 0.89
79 0.88
80 0.87
81 0.85
82 0.79
83 0.76
84 0.67
85 0.59
86 0.55
87 0.56
88 0.51
89 0.48
90 0.46
91 0.44
92 0.48
93 0.52
94 0.5
95 0.46
96 0.5
97 0.46
98 0.49
99 0.51
100 0.45
101 0.43
102 0.38
103 0.32
104 0.25
105 0.27
106 0.26
107 0.27
108 0.36
109 0.4
110 0.48
111 0.59
112 0.68
113 0.72
114 0.81
115 0.84
116 0.85
117 0.9
118 0.9
119 0.82
120 0.81
121 0.76
122 0.74
123 0.71
124 0.64
125 0.56
126 0.5
127 0.46
128 0.37
129 0.31
130 0.23
131 0.16
132 0.12
133 0.1
134 0.11
135 0.11
136 0.12
137 0.12
138 0.13
139 0.13
140 0.16
141 0.19
142 0.2
143 0.23
144 0.27
145 0.27
146 0.28
147 0.31
148 0.32
149 0.31
150 0.28
151 0.29
152 0.28
153 0.28
154 0.26
155 0.21
156 0.18
157 0.18
158 0.18
159 0.13
160 0.11
161 0.11
162 0.13
163 0.16
164 0.16
165 0.14
166 0.14
167 0.15
168 0.17
169 0.23
170 0.24
171 0.26
172 0.34
173 0.41
174 0.42
175 0.47
176 0.52
177 0.55
178 0.57
179 0.57
180 0.57
181 0.51
182 0.52
183 0.49
184 0.48
185 0.45
186 0.41
187 0.37
188 0.34
189 0.33
190 0.32
191 0.31
192 0.23
193 0.18
194 0.17
195 0.18
196 0.12
197 0.11
198 0.11
199 0.1