Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F9E9

Protein Details
Accession A7F9E9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-51AGFSTQGKPKKPKENPNIDKRQRRIDEHydrophilic
NLS Segment(s)
PositionSequence
33-38PKKPKE
Subcellular Location(s) cyto 14, nucl 8, cyto_pero 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR020993  Centromere_CenpK  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0051382  P:kinetochore assembly  
KEGG ssl:SS1G_14230  -  
Amino Acid Sequences MLAAEELGGPIVGEMLDVTPEALIAGFSTQGKPKKPKENPNIDKRQRRIDEIWGPKPSLDENGEDEEEEEWNETRAAGAEMRELAEQLLNGLLEADDHGTDGYVTLERDSAAARFLVRSKVAQYHFKDARKLKLIDFEKDII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.06
15 0.09
16 0.14
17 0.19
18 0.27
19 0.35
20 0.43
21 0.53
22 0.61
23 0.7
24 0.75
25 0.82
26 0.84
27 0.86
28 0.89
29 0.87
30 0.87
31 0.81
32 0.8
33 0.72
34 0.68
35 0.61
36 0.58
37 0.58
38 0.57
39 0.59
40 0.51
41 0.48
42 0.42
43 0.4
44 0.32
45 0.26
46 0.2
47 0.15
48 0.15
49 0.17
50 0.17
51 0.16
52 0.16
53 0.13
54 0.11
55 0.1
56 0.08
57 0.05
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.08
96 0.08
97 0.07
98 0.07
99 0.08
100 0.08
101 0.1
102 0.12
103 0.15
104 0.16
105 0.17
106 0.2
107 0.27
108 0.31
109 0.38
110 0.41
111 0.47
112 0.53
113 0.55
114 0.61
115 0.59
116 0.64
117 0.63
118 0.61
119 0.53
120 0.56
121 0.57
122 0.53