Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2RP21

Protein Details
Accession W2RP21    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-35RPLKRIRQACEPCRRKKSRCPGEKPVCSHCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MESSERPLKRIRQACEPCRRKKSRCPGEKPVCSHCARLGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.77
4 0.76
5 0.79
6 0.83
7 0.78
8 0.78
9 0.8
10 0.8
11 0.81
12 0.81
13 0.81
14 0.84
15 0.86
16 0.82
17 0.77
18 0.74
19 0.66
20 0.6