Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2S8M2

Protein Details
Accession W2S8M2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
148-168QREVEQERKRRDKVKGRRAGEBasic
NLS Segment(s)
PositionSequence
155-165RKRRDKVKGRR
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 11.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MEPPQDPSGGGGGPPPVFAGGPPQGAPQLPPQMFTTAAQLLDLTDKKLLLVLRDGRKLHGVLRTWDQFANLVLTETRERYFCTSPSSFSSPESSSNDAPRKLYCDVPRGTYLVRGENVLLIGEVDLDQDDEPPPGYEEGDVEEVFRLQREVEQERKRRDKVKGRRAGELWGGELEGSGEVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.11
5 0.11
6 0.15
7 0.15
8 0.17
9 0.17
10 0.18
11 0.19
12 0.19
13 0.21
14 0.2
15 0.27
16 0.25
17 0.27
18 0.27
19 0.27
20 0.28
21 0.27
22 0.25
23 0.18
24 0.17
25 0.15
26 0.13
27 0.12
28 0.16
29 0.16
30 0.13
31 0.12
32 0.12
33 0.12
34 0.14
35 0.15
36 0.11
37 0.17
38 0.23
39 0.28
40 0.34
41 0.34
42 0.33
43 0.35
44 0.35
45 0.31
46 0.29
47 0.26
48 0.24
49 0.29
50 0.3
51 0.29
52 0.28
53 0.26
54 0.2
55 0.19
56 0.17
57 0.11
58 0.09
59 0.08
60 0.09
61 0.1
62 0.11
63 0.11
64 0.1
65 0.11
66 0.15
67 0.17
68 0.16
69 0.21
70 0.2
71 0.21
72 0.25
73 0.27
74 0.24
75 0.23
76 0.25
77 0.2
78 0.23
79 0.24
80 0.23
81 0.21
82 0.26
83 0.29
84 0.26
85 0.26
86 0.23
87 0.24
88 0.23
89 0.27
90 0.25
91 0.28
92 0.28
93 0.3
94 0.31
95 0.28
96 0.27
97 0.25
98 0.23
99 0.2
100 0.19
101 0.16
102 0.15
103 0.14
104 0.14
105 0.1
106 0.08
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.06
117 0.06
118 0.07
119 0.07
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.1
126 0.12
127 0.11
128 0.11
129 0.1
130 0.11
131 0.11
132 0.11
133 0.09
134 0.07
135 0.09
136 0.15
137 0.21
138 0.3
139 0.4
140 0.48
141 0.58
142 0.67
143 0.71
144 0.73
145 0.77
146 0.78
147 0.8
148 0.82
149 0.83
150 0.77
151 0.79
152 0.73
153 0.68
154 0.63
155 0.54
156 0.44
157 0.35
158 0.31
159 0.22
160 0.21
161 0.16
162 0.09