Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ED89

Protein Details
Accession A7ED89    Localization Confidence High Confidence Score 25.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-135AKTLKASKRKRTDGEGKKPKEGKREKKKRPRRDSDEDPDGIBasic
137-159IDGKRVRKPKRVDGDRKERDRTKBasic
188-209MDAALKNPNKRRRKKDEVDLEEHydrophilic
NLS Segment(s)
PositionSequence
99-127KASKRKRTDGEGKKPKEGKREKKKRPRRD
139-164GKRVRKPKRVDGDRKERDRTKERRKA
179-202RRRRALDKAMDAALKNPNKRRRKK
454-458QGKKR
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035441  TFIIS/LEDGF_dom_sf  
IPR017923  TFIIS_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
KEGG ssl:SS1G_03279  -  
Pfam View protein in Pfam  
PF08711  Med26  
PROSITE View protein in PROSITE  
PS51319  TFIIS_N  
Amino Acid Sequences MSDTDLDSRLTTPLPEAGNDAGDPNRPISQERDTPEPPMANPDLDMDDLDNAENGAESDNESDLSEVDEANFDDFDASKVALDERPMVGIDEDVAKTLKASKRKRTDGEGKKPKEGKREKKKRPRRDSDEDPDGIEIDGKRVRKPKRVDGDRKERDRTKERRKATPEPENDENLTPDERRRRALDKAMDAALKNPNKRRRKKDEVDLEEAFDDEIAALKLRMEEACQADNAARDANLPATRKLEMLPEVVALLNRNTIQHSIVDPDTNFLQSVKFFLEPLNDGSLPAYNIQRDLFQALARLPIEKEALLSSGIGKVVLYYTKSKRPEIGIKRIAERLLGEWSRPILKRSDDYKKRKVATKEFDHQAAQLAIRPSGSQSSQMPSSQRTQLTARDIERQRLLAPKIISNRARMETSNTSYSIAPRSNFDPSRGLDPASRPIGAGGVDAFRKMTAKQGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.2
4 0.19
5 0.2
6 0.2
7 0.2
8 0.17
9 0.19
10 0.19
11 0.19
12 0.21
13 0.21
14 0.23
15 0.26
16 0.32
17 0.36
18 0.38
19 0.44
20 0.42
21 0.44
22 0.47
23 0.44
24 0.37
25 0.37
26 0.35
27 0.27
28 0.26
29 0.25
30 0.22
31 0.2
32 0.2
33 0.14
34 0.13
35 0.13
36 0.12
37 0.1
38 0.08
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.1
52 0.09
53 0.08
54 0.08
55 0.09
56 0.09
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.09
65 0.08
66 0.09
67 0.1
68 0.11
69 0.12
70 0.14
71 0.13
72 0.14
73 0.14
74 0.14
75 0.12
76 0.11
77 0.1
78 0.11
79 0.1
80 0.1
81 0.1
82 0.1
83 0.1
84 0.17
85 0.21
86 0.28
87 0.37
88 0.46
89 0.56
90 0.65
91 0.69
92 0.71
93 0.77
94 0.79
95 0.81
96 0.82
97 0.76
98 0.77
99 0.79
100 0.75
101 0.75
102 0.75
103 0.74
104 0.75
105 0.82
106 0.84
107 0.88
108 0.95
109 0.95
110 0.95
111 0.95
112 0.93
113 0.92
114 0.9
115 0.88
116 0.85
117 0.74
118 0.64
119 0.53
120 0.44
121 0.34
122 0.26
123 0.17
124 0.13
125 0.15
126 0.16
127 0.2
128 0.28
129 0.34
130 0.41
131 0.48
132 0.54
133 0.62
134 0.71
135 0.77
136 0.8
137 0.85
138 0.86
139 0.85
140 0.83
141 0.78
142 0.76
143 0.75
144 0.76
145 0.76
146 0.75
147 0.74
148 0.76
149 0.78
150 0.79
151 0.78
152 0.77
153 0.72
154 0.7
155 0.68
156 0.61
157 0.55
158 0.46
159 0.37
160 0.29
161 0.25
162 0.19
163 0.2
164 0.26
165 0.26
166 0.28
167 0.31
168 0.34
169 0.37
170 0.45
171 0.45
172 0.4
173 0.41
174 0.4
175 0.37
176 0.33
177 0.3
178 0.3
179 0.28
180 0.29
181 0.35
182 0.43
183 0.52
184 0.61
185 0.69
186 0.71
187 0.78
188 0.8
189 0.82
190 0.83
191 0.8
192 0.77
193 0.67
194 0.58
195 0.47
196 0.4
197 0.29
198 0.18
199 0.11
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.04
206 0.04
207 0.05
208 0.05
209 0.05
210 0.08
211 0.1
212 0.11
213 0.11
214 0.11
215 0.11
216 0.11
217 0.11
218 0.08
219 0.06
220 0.06
221 0.06
222 0.09
223 0.11
224 0.12
225 0.13
226 0.15
227 0.15
228 0.15
229 0.15
230 0.15
231 0.14
232 0.13
233 0.12
234 0.1
235 0.1
236 0.1
237 0.09
238 0.08
239 0.06
240 0.07
241 0.07
242 0.07
243 0.08
244 0.09
245 0.09
246 0.1
247 0.1
248 0.12
249 0.12
250 0.13
251 0.12
252 0.13
253 0.12
254 0.12
255 0.11
256 0.08
257 0.09
258 0.07
259 0.09
260 0.09
261 0.09
262 0.09
263 0.09
264 0.11
265 0.12
266 0.13
267 0.15
268 0.14
269 0.13
270 0.14
271 0.14
272 0.12
273 0.13
274 0.13
275 0.09
276 0.11
277 0.11
278 0.11
279 0.11
280 0.12
281 0.11
282 0.1
283 0.11
284 0.1
285 0.13
286 0.12
287 0.13
288 0.11
289 0.12
290 0.13
291 0.11
292 0.12
293 0.09
294 0.1
295 0.09
296 0.09
297 0.08
298 0.08
299 0.08
300 0.07
301 0.07
302 0.06
303 0.07
304 0.08
305 0.1
306 0.15
307 0.2
308 0.27
309 0.31
310 0.33
311 0.35
312 0.4
313 0.48
314 0.5
315 0.56
316 0.56
317 0.55
318 0.57
319 0.57
320 0.51
321 0.41
322 0.34
323 0.25
324 0.25
325 0.23
326 0.2
327 0.19
328 0.2
329 0.25
330 0.25
331 0.25
332 0.22
333 0.25
334 0.31
335 0.38
336 0.47
337 0.52
338 0.6
339 0.67
340 0.72
341 0.73
342 0.75
343 0.76
344 0.75
345 0.75
346 0.75
347 0.74
348 0.69
349 0.67
350 0.6
351 0.51
352 0.44
353 0.36
354 0.27
355 0.22
356 0.2
357 0.17
358 0.17
359 0.17
360 0.15
361 0.17
362 0.17
363 0.17
364 0.17
365 0.21
366 0.24
367 0.26
368 0.28
369 0.27
370 0.31
371 0.34
372 0.33
373 0.32
374 0.33
375 0.36
376 0.4
377 0.43
378 0.4
379 0.43
380 0.45
381 0.48
382 0.48
383 0.44
384 0.4
385 0.41
386 0.41
387 0.38
388 0.37
389 0.37
390 0.41
391 0.48
392 0.49
393 0.46
394 0.5
395 0.47
396 0.48
397 0.42
398 0.43
399 0.42
400 0.45
401 0.43
402 0.38
403 0.36
404 0.35
405 0.36
406 0.35
407 0.32
408 0.27
409 0.27
410 0.3
411 0.37
412 0.38
413 0.39
414 0.38
415 0.36
416 0.42
417 0.4
418 0.39
419 0.34
420 0.36
421 0.4
422 0.38
423 0.35
424 0.29
425 0.28
426 0.27
427 0.23
428 0.2
429 0.14
430 0.14
431 0.14
432 0.15
433 0.15
434 0.14
435 0.15
436 0.15
437 0.23
438 0.3