Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E4N2

Protein Details
Accession A7E4N2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-49PIKFLCAKSLKKNKGKGRSTLHydrophilic
214-245PYQLTVNMRAKWRKKRTRRLKRKRRKTRARSKBasic
NLS Segment(s)
PositionSequence
222-245RAKWRKKRTRRLKRKRRKTRARSK
Subcellular Location(s) nucl 16.5, mito_nucl 13, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ssl:SS1G_00254  -  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MTKPLTFVLMKLRFFEYTRGSEDLTLMVPIKFLCAKSLKKNKGKGRSTLQEDMGSDDAEFMGTASDGVGLSDELSEIEDDVASDFHHESDSEESEEHDDEIEGYTEDQTRNDPMQAKLDAGLLKGIELEDFVSEQQPDALAQQSRAAKERGVVRNKFFMCGGVAGIKMGGSFECSNCPKISNCAKLARKLSEVDHHIWSFNQQNFLSLLTTPTPYQLTVNMRAKWRKKRTRRLKRKRRKTRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.34
4 0.31
5 0.35
6 0.34
7 0.32
8 0.3
9 0.29
10 0.25
11 0.2
12 0.17
13 0.14
14 0.11
15 0.11
16 0.1
17 0.13
18 0.14
19 0.13
20 0.17
21 0.23
22 0.29
23 0.39
24 0.5
25 0.57
26 0.63
27 0.73
28 0.77
29 0.81
30 0.82
31 0.79
32 0.78
33 0.77
34 0.76
35 0.72
36 0.65
37 0.57
38 0.51
39 0.46
40 0.38
41 0.29
42 0.21
43 0.15
44 0.12
45 0.09
46 0.09
47 0.05
48 0.04
49 0.04
50 0.04
51 0.03
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.04
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.08
76 0.1
77 0.12
78 0.11
79 0.11
80 0.11
81 0.13
82 0.13
83 0.11
84 0.09
85 0.07
86 0.06
87 0.07
88 0.07
89 0.05
90 0.05
91 0.06
92 0.07
93 0.08
94 0.08
95 0.08
96 0.1
97 0.11
98 0.13
99 0.15
100 0.14
101 0.18
102 0.18
103 0.17
104 0.15
105 0.16
106 0.14
107 0.12
108 0.11
109 0.07
110 0.07
111 0.07
112 0.06
113 0.04
114 0.04
115 0.04
116 0.03
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.08
127 0.08
128 0.08
129 0.13
130 0.15
131 0.16
132 0.18
133 0.18
134 0.16
135 0.19
136 0.27
137 0.31
138 0.37
139 0.4
140 0.4
141 0.47
142 0.47
143 0.45
144 0.36
145 0.29
146 0.21
147 0.18
148 0.17
149 0.1
150 0.09
151 0.08
152 0.08
153 0.07
154 0.06
155 0.05
156 0.05
157 0.07
158 0.08
159 0.09
160 0.15
161 0.17
162 0.19
163 0.2
164 0.22
165 0.19
166 0.26
167 0.34
168 0.35
169 0.37
170 0.45
171 0.48
172 0.53
173 0.58
174 0.54
175 0.48
176 0.44
177 0.43
178 0.41
179 0.42
180 0.38
181 0.38
182 0.35
183 0.33
184 0.3
185 0.31
186 0.31
187 0.28
188 0.31
189 0.25
190 0.27
191 0.27
192 0.28
193 0.25
194 0.18
195 0.18
196 0.13
197 0.15
198 0.14
199 0.16
200 0.16
201 0.15
202 0.16
203 0.2
204 0.24
205 0.32
206 0.39
207 0.41
208 0.48
209 0.57
210 0.65
211 0.7
212 0.75
213 0.77
214 0.81
215 0.88
216 0.92
217 0.94
218 0.96
219 0.96
220 0.97
221 0.97
222 0.98
223 0.98
224 0.98
225 0.98