Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W2RUS6

Protein Details
Accession W2RUS6    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPVRSPTLSRDKRWKPKTDNYPQSHKSHydrophilic
51-72RTGNTIRYNAKRRHWRKTRIGIHydrophilic
NLS Segment(s)
PositionSequence
60-69AKRRHWRKTR
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPVRSPTLSRDKRWKPKTDNYPQSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.83
4 0.87
5 0.87
6 0.87
7 0.82
8 0.83
9 0.77
10 0.74
11 0.69
12 0.62
13 0.6
14 0.59
15 0.63
16 0.63
17 0.65
18 0.66
19 0.7
20 0.76
21 0.75
22 0.75
23 0.76
24 0.76
25 0.77
26 0.8
27 0.77
28 0.74
29 0.71
30 0.68
31 0.63
32 0.62
33 0.63
34 0.57
35 0.56
36 0.53
37 0.5
38 0.5
39 0.52
40 0.51
41 0.47
42 0.49
43 0.5
44 0.55
45 0.61
46 0.62
47 0.65
48 0.68
49 0.72
50 0.77
51 0.81
52 0.83